DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KFase and Aadacl3

DIOPT Version :10

Sequence 1:NP_609036.1 Gene:KFase / 33907 FlyBaseID:FBgn0287695 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001078972.1 Gene:Aadacl3 / 230883 MGIID:2685281 Length:408 Species:Mus musculus


Alignment Length:258 Identity:60/258 - (23%)
Similarity:97/258 - (37%) Gaps:71/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RELTEKQGITVDHLRYGEGRQLVDV-FYSEKTTNQAPL--FVFVHGGYWQE----------MDMS 96
            :.|.....:.|..|.:|    .:.| .|..|..:..|.  .:|.|||....          :.:|
Mouse    80 KPLKRDPDVVVKDLHFG----TIPVKLYKPKKPSSIPRLGIIFFHGGGTIIGSLRTHNSICLRLS 140

  Fly    97 MSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDY-TEMTKVSSLTFAGHSAG- 159
            ..|..|  :|..|||.:.| |..  .|..:..:...||||..:..| .:..:|.:   .|.|.| 
Mouse   141 KECDSV--VVSVGYRKSPM-YKY--PVMKDDCVVATTHFLESLDVYGVDPARVVT---CGDSVGG 197

  Fly   160 --AHLLAQILM-RPNV--ITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVS 219
              |.:.:|:|: ||::  |.||           ..:|.|.:|.:..|.:.:     ..|||    
Mouse   198 TAATVTSQMLVHRPDLPRIKAQ-----------ILIYPLLQLIDFGSPSYQ-----QNRNI---- 242

  Fly   220 PML-WE--------YTDVTV-WNSTKIYVVAAEHDSTTFIEQSRHY------ADVLRKKGYKA 266
            |:| |:        :.||.: |.|.   |....|......|:.|.:      .:..:.:|||:
Mouse   243 PLLSWDLAFYCFCCHLDVNISWKSV---VKNGMHLPPDVWEKYRKWLGAENIPERFKNRGYKS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KFaseNP_609036.1 Aes 68..295 CDD:440422 56/235 (24%)
Aadacl3NP_001078972.1 Abhydrolase_3 116..379 CDD:400284 52/218 (24%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 120..122 1/1 (100%)

Return to query results.
Submit another query.