DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KFase and afmd-1

DIOPT Version :9

Sequence 1:NP_001285676.1 Gene:KFase / 33907 FlyBaseID:FBgn0031821 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_501149.1 Gene:afmd-1 / 177499 WormBaseID:WBGene00017051 Length:271 Species:Caenorhabditis elegans


Alignment Length:318 Identity:70/318 - (22%)
Similarity:130/318 - (40%) Gaps:76/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYNPRC----KDLD---RDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHL 58
            :|:|.|    |:.|   .|:|                |.:::.....| :..::..|:.:.    
 Worm     7 LYSPSCWVPGKNRDEVMNDFF----------------AGIKNAFEALK-NDEKIPRKENVA---- 50

  Fly    59 RYG-EGRQLVDVF--YSEKTTNQAPLFVFVHGGYW-----QEMDMSMSCSIVGPLVRRGYRVAVM 115
             || |..|.||::  .|:|      |.:|:|||||     ::......|::     ...|..|.:
 Worm    51 -YGMEENQKVDIWGDASDK------LLIFIHGGYWAAGTRKDCLTPARCAL-----NNEYAFASV 103

  Fly   116 DYNLCPQ-VTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHSAGAHLLAQILMRPNVITAQRSK 179
            .|.|..: .||.:.:....:.:::|...  ...||::...||||||||..      |.:...|:.
 Worm   104 GYGLSTEGRTLTETVEDVVNGVDFILKL--YPNVSNVLVGGHSAGAHLAM------NAVARLRNP 160

  Fly   180 MVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKI--YVVAAE 242
            .:..|:...|.|.|.||...|.....| |..::..:.|        .|::..:..|:  .|:...
 Worm   161 RIRGLLLFSGCYFLEELIGTEIGTDIN-LTTDQAKLNS--------CDLSKLDGLKLDSLVILGL 216

  Fly   243 HDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHF----DIIEETAIDDSDVSRFLRN 296
            .::...|||:|   |.:.::| ::....|....|:    :::..|:.:...:.:||:|
 Worm   217 QEAPKLIEQNR---DFVAQQG-QSRIEEFPNSGHYTIMTNLLNHTSGEYLAMEKFLKN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KFaseNP_001285676.1 Aes <67..297 CDD:223730 56/244 (23%)
Abhydrolase 82..276 CDD:304388 46/201 (23%)
afmd-1NP_501149.1 Aes 26..>169 CDD:223730 40/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158724
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41731
Inparanoid 1 1.050 50 1.000 Inparanoid score I4109
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63382
OrthoDB 1 1.010 - - D608656at33208
OrthoFinder 1 1.000 - - FOG0002751
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107374
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3743
SonicParanoid 1 1.000 - - X4210
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.700

Return to query results.
Submit another query.