DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KFase and AADACL3

DIOPT Version :10

Sequence 1:NP_609036.1 Gene:KFase / 33907 FlyBaseID:FBgn0287695 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001096640.2 Gene:AADACL3 / 126767 HGNCID:32037 Length:407 Species:Homo sapiens


Alignment Length:70 Identity:16/70 - (22%)
Similarity:28/70 - (40%) Gaps:14/70 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPAAKPSSTTATANTNTGHTPSGAQSVSSSASTVSSAS------------ESSETALSPSRRSR- 54
            |..::.||.|....::||..|.|......:.|..|:.:            :.||...:.|::|. 
Human   219 KAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHH 283

  Fly    55 -LHEK 58
             .|:|
Human   284 IRHQK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KFaseNP_609036.1 Aes 68..295 CDD:440422
AADACL3NP_001096640.2 Abhydrolase_3 115..378 CDD:400284 16/70 (23%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 119..121
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.