DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9536 and pdh1

DIOPT Version :9

Sequence 1:NP_001188706.1 Gene:CG9536 / 33904 FlyBaseID:FBgn0031818 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_587734.1 Gene:pdh1 / 2539043 PomBaseID:SPCC1235.08c Length:226 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:40/205 - (19%)
Similarity:87/205 - (42%) Gaps:19/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VITLICVVTTFG---YLLSFSETAILLLSVTPGYILPNGKF-WIWTAFTFCFIELHWWEVAVDVV 86
            ::.::....:||   |:..|..::|:...:...:::||..| :.||..|..|::.:.:.:...::
pombe    15 ILEVLFSAISFGISIYIKVFGRSSIVTFFLLCFHLVPNALFLFPWTIITTSFVDANVFTLLSSIL 79

  Fly    87 TVGLCGKMLEPLWGQLEMFKFFALSNFGVSLLTTVYYLFYYMVTKNPTILFEVHIHGLAGYVAGI 151
            .:.:.|..:|..||..|...|........::...:.....|.:|.:..:|..: |.......|||
pombe    80 ILSVYGVEIERSWGHKEYLLFCQFLTVIPNIAVLIPCFIAYKITDSHYLLVAI-IQSTTAIQAGI 143

  Fly   152 CVAVRQIMPDHLIFKTRYGRLTNRNV-PLTVLIMAIIL-----WAIGLLDGTYPAMFASGSLVSW 210
            ..|..|      ::..:....:|:.: ||:..::.:.|     :.......||..:..||:.:|.
pombe   144 LTAWYQ------LYSCKKEESSNKFLCPLSKYLIYLFLSIHLFYVFQSFPWTYFCLAVSGTCISE 202

  Fly   211 IYLRFYQHHP 220
            :|:.|.  ||
pombe   203 LYVLFV--HP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9536NP_001188706.1 DUF1751 54..157 CDD:285722 21/103 (20%)
pdh1NP_587734.1 DUF1751 51..149 CDD:285722 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2890
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103163
Panther 1 1.100 - - LDO PTHR13377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.