DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and AT1G74770

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_177615.2 Gene:AT1G74770 / 843816 AraportID:AT1G74770 Length:1259 Species:Arabidopsis thaliana


Alignment Length:310 Identity:111/310 - (35%)
Similarity:158/310 - (50%) Gaps:24/310 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LNCDGMAEPMEEDQLHRFAACSRNPAAEAQQHAQPSCNSSSSSSDGSCNSNKCSSNICGAQPT-- 175
            ::||...:|.::|.:.:....||...::...:.:||..||:..:            :.|..|:  
plant   964 ISCDSSLDPQKKDYIKQNLLMSRWNISQRTYNLEPSSLSSNMET------------VHGQHPSYR 1016

  Fly   176 TPESLRFGCAHYKRRAMFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQCL 240
            .|.||.|||.||||....:.|||:|.:.|..||||...|..|||.:|:::|.:|...|.:...|.
plant  1017 DPHSLIFGCNHYKRNCKLLAPCCDKLFTCIRCHDEEADHSVDRKQITKMMCMKCLLIQPIGANCS 1081

  Fly   241 N--CGVRFGKYTCLICNLFDDADKQQYHCHGCGICRIG---GAENFFHCEVCNMCLPIQLKIDGH 300
            |  |....|||.|.||.|:|| :::.|||..|.:||:|   |.: :|||..||.|:...|.  .|
plant  1082 NTSCKSSMGKYFCKICKLYDD-ERKIYHCPYCNLCRVGKGLGID-YFHCMKCNACMSRTLV--EH 1142

  Fly   301 RCVENISRSHCPVCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWV 365
            .|.|.....:||:|...|.||..|.....||||:|..||.:...| |||||.|..||.||...:.
plant  1143 VCREKCLEDNCPICHEYIFTSSSPVKALPCGHLMHSTCFQEYTCS-HYTCPVCSKSLGDMQVYFK 1206

  Fly   366 YLDDQAERMPVPLKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNT 415
            .||.......:|.:|.|:...|.||||.:.....:|::..||..||:||:
plant  1207 MLDALLAEEKMPDEYSNKTQVILCNDCGRKGNAPYHWLYHKCTTCGSYNS 1256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 31/74 (42%)
RING 311..357 CDD:238093 21/45 (47%)
zinc_ribbon_6 358..416 CDD:291274 19/58 (33%)
AT1G74770NP_177615.2 Hr-like 37..168 CDD:213983
Hr-like 618..764 CDD:213983
zf-CHY 1025..1100 CDD:283213 31/74 (42%)
zf-RING_2 1151..1194 CDD:290367 20/43 (47%)
zinc_ribbon_6 1199..1257 CDD:291274 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2987
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101709
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.670

Return to query results.
Submit another query.