DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and AT5G25560

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001318650.1 Gene:AT5G25560 / 832631 AraportID:AT5G25560 Length:318 Species:Arabidopsis thaliana


Alignment Length:304 Identity:114/304 - (37%)
Similarity:156/304 - (51%) Gaps:36/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 EAQQHAQP-SCNSSSSSSDGSCNSNKCSSNICGAQPTTPESL-----RFGCAHYKRRAMFVTPCC 198
            |..:|:.| |.|..|.||         :.....|:..|.:.|     .:||.||:||.....|||
plant    22 EMSRHSHPHSINEESESS---------TLERVAAESLTNKVLDRGLMEYGCPHYRRRCCIRAPCC 77

  Fly   199 NKFYKCRFCH---------DENETHHFDRKTLTEL----------ICSECNTRQTVREQCLNCGV 244
            |:.:.|..||         |:.:.|...|..:.:|          ||..|.|.|.|.:.|::|||
plant    78 NEIFGCHHCHYEAKNNINVDQKQRHDIPRHQVEQLTRPLSSSSQVICLLCGTEQEVGQICIHCGV 142

  Fly   245 RFGKYTCLICNLF-DDADKQQYHCHGCGICRIGGAENFFHCEVCNMCLPIQLKIDGHRCVENISR 308
            ..|||.|.:|.|: ||..|:||||.|||||||||.||||||..|..|..|.|| :||.|||....
plant   143 CMGKYFCKVCKLYDDDTSKKQYHCDGCGICRIGGRENFFHCYKCGCCYSILLK-NGHPCVEGAMH 206

  Fly   309 SHCPVCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWVYLDDQAER 373
            ..||:|...:..||....:..|||.:|:.|.:::.....|.||.|..|:.||:.:|...|.:...
plant   207 HDCPICFEFLFESRNDVTVLPCGHTIHQKCLEEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAA 271

  Fly   374 MPVPLKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNTTQ 417
            .|:|..|:|:.|.|.||||.|.::.::|.:..||.:|.:|||.|
plant   272 TPMPEPYQNRMVQILCNDCGKKAEVQYHVVAQKCPNCKSYNTRQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 31/91 (34%)
RING 311..357 CDD:238093 14/45 (31%)
zinc_ribbon_6 358..416 CDD:291274 21/57 (37%)
AT5G25560NP_001318650.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2987
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 251 1.000 Inparanoid score I1027
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - otm2803
orthoMCL 1 0.900 - - OOG6_101709
Panther 1 1.100 - - O PTHR21319
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.