DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and AT5G22920

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_197683.1 Gene:AT5G22920 / 832356 AraportID:AT5G22920 Length:291 Species:Arabidopsis thaliana


Alignment Length:246 Identity:107/246 - (43%)
Similarity:139/246 - (56%) Gaps:11/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 FGCAHYKRRAMFVTPCCNKFYKCRFCHDEN------ETHH---FDRKTLTELICSECNTRQTVRE 237
            :||:||:||.....|||::.:.||.||:|.      |.||   ..|..::::|||.|.|.|.|::
plant    25 YGCSHYRRRCKIRAPCCDEIFDCRHCHNEAKDSLHIEQHHRHELPRHEVSKVICSLCETEQDVQQ 89

  Fly   238 QCLNCGVRFGKYTCLICNLF-DDADKQQYHCHGCGICRIGGAENFFHCEVCNMCLPIQLKIDGHR 301
            .|.||||..|||.|..|..| ||..|:||||..|||||.||.||||||:.|..|.. ::..|.|:
plant    90 NCSNCGVCMGKYFCSKCKFFDDDLSKKQYHCDECGICRTGGEENFFHCKRCRCCYS-KIMEDKHQ 153

  Fly   302 CVENISRSHCPVCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWVY 366
            |||.....:||||...:..|.....:..|||.:|..|...:.....||||.|..|:.||:.||..
plant   154 CVEGAMHHNCPVCFEYLFDSTRDITVLRCGHTMHLECTKDMGLHNRYTCPVCSKSICDMSNLWKK 218

  Fly   367 LDDQAERMPVPLKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNTTQ 417
            ||::....|:|..|||:.|.|.||||...:..:||.|..||..||:|||.|
plant   219 LDEEVAAYPMPKMYENKMVWILCNDCGSNTNVRFHLIAHKCSSCGSYNTRQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 34/81 (42%)
RING 311..357 CDD:238093 15/45 (33%)
zinc_ribbon_6 358..416 CDD:291274 26/57 (46%)
AT5G22920NP_197683.1 zf-CHY 27..109 CDD:398899 34/81 (42%)
RING_Ubox 162..206 CDD:418438 14/43 (33%)
RING-H2 finger (C3H2C3-type) 163..205 CDD:319361 14/41 (34%)
zinc_ribbon_6 210..268 CDD:405307 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2987
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 251 1.000 Inparanoid score I1027
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - otm2803
orthoMCL 1 0.900 - - OOG6_101709
Panther 1 1.100 - - LDO PTHR21319
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.