DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and AT3G62970

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_191856.4 Gene:AT3G62970 / 825472 AraportID:AT3G62970 Length:287 Species:Arabidopsis thaliana


Alignment Length:294 Identity:122/294 - (41%)
Similarity:161/294 - (54%) Gaps:26/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SSSSSSDGSCNSNKCSSNICGAQPTTPE--SLRFGCAHYKRRAMFVTPCCNKFYKCRFCH----- 208
            |:|..||....:....|:|    |...:  ..:|||.|||||.....||||..:.||.||     
plant     4 SASLQSDSMEAAAAADSSI----PRDKDFGKFQFGCEHYKRRCKIRAPCCNLIFSCRHCHNDSAN 64

  Fly   209 ---DENETHHFDRKTLTELICSECNTRQTVREQCLNCGVRFGKYTCLICNLF-DDADKQQYHCHG 269
               |..|.|...|:.:.:::||.|.|.|.|.:.|.||||..|:|.|.||..| ||..|:|:||..
plant    65 SLPDPKERHDLVRQNVKQVVCSICQTEQEVAKVCSNCGVNMGEYFCDICKFFDDDISKEQFHCDD 129

  Fly   270 CGICRIGGAENFFHCEVCNMCLPIQLKIDGHRCVENISRSHCPVCLGDIHTSRIPCHIPDCGHLL 334
            |||||:||.:.||||:.|..|..:.|: |.|.|:||.:::.||||...:..|....|:..|||.:
plant   130 CGICRVGGRDKFFHCQNCGACYGMGLR-DKHSCIENSTKNSCPVCYEYLFDSVKAAHVMKCGHTM 193

  Fly   335 HKMCFDQLLASGHYTCPTCQTSLIDMTALWVYLDDQ--AERMPVPLKYENQRVHIFCNDCHKTSK 397
            |..||:|::....|.||.|..|::||:..|..||.:  |..|||..|:|   |.|.||||:|.||
plant   194 HMDCFEQMINENQYRCPICAKSMVDMSPSWHLLDFEISATEMPVEYKFE---VSILCNDCNKGSK 255

  Fly   398 TKFHFIGLKCVHCGAYNTTQDVKRRLSLVTDEPS 431
            ..||.:|.||..||:|||     ||:|...|..|
plant   256 AMFHILGHKCSDCGSYNT-----RRISTPQDPVS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 34/80 (43%)
RING 311..357 CDD:238093 17/45 (38%)
zinc_ribbon_6 358..416 CDD:291274 29/59 (49%)
AT3G62970NP_191856.4 zf-CHY 35..116 CDD:283213 34/80 (43%)
RING 170..212 CDD:238093 16/41 (39%)
zinc_ribbon_6 217..274 CDD:291274 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2987
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22894
Inparanoid 1 1.050 251 1.000 Inparanoid score I1027
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - otm2803
orthoMCL 1 0.900 - - OOG6_101709
Panther 1 1.100 - - O PTHR21319
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.