DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and BTS

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_188457.1 Gene:BTS / 821357 AraportID:AT3G18290 Length:1254 Species:Arabidopsis thaliana


Alignment Length:360 Identity:119/360 - (33%)
Similarity:169/360 - (46%) Gaps:46/360 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PNPHLHQQHQLIVTPTTMTGK----------YHPAHAKLRRCKSTPSLNCDGMAEPMEEDQLHRF 130
            |:|.....||.|:..:....|          .:...|::|:...      |...:|..:|.|.:.
plant   905 PSPQKDNDHQEILDQSGELFKPGWKDIFRMNQNELEAEIRKVYQ------DSTLDPRRKDYLVQN 963

  Fly   131 AACSRNPAAEAQ--QHAQPSCNSSSSSSDGSCNSNKCSSNICGAQPT--TPESLRFGCAHYKRRA 191
            ...||..||:.:  :.|:.:.|....               .|..|:  .||...:||.||||..
plant   964 WRTSRWIAAQQKLPKEAETAVNGDVE---------------LGCSPSFRDPEKQIYGCEHYKRNC 1013

  Fly   192 MFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQCL--NC-GVRFGKYTCLI 253
            .....||::.:.||||||:...|..|||.:||::|..|...|.|...|.  :| |....|:.|.|
plant  1014 KLRAACCDQLFTCRFCHDKVSDHSMDRKLVTEMLCMRCLKVQPVGPICTTPSCDGFPMAKHYCSI 1078

  Fly   254 CNLFDDADKQQYHCHGCGICRIG---GAENFFHCEVCNMCLPIQLKIDGHRCVENISRSHCPVCL 315
            |.|||| ::..|||..|.:||:|   |.: ||||..||.||  .:|:..|:|:|....::||:|.
plant  1079 CKLFDD-ERAVYHCPFCNLCRVGEGLGID-FFHCMTCNCCL--GMKLVNHKCLEKSLETNCPICC 1139

  Fly   316 GDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWVYLDDQAERMPVPLKY 380
            ..:.||........|||.:|..|| |.....|||||.|..||.||...:..||.......:|.:|
plant  1140 EFLFTSSEAVRALPCGHYMHSACF-QAYTCSHYTCPICGKSLGDMAVYFGMLDALLAAEELPEEY 1203

  Fly   381 ENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNT 415
            :|:...|.||||.:...|:||::..||..||:|||
plant  1204 KNRCQDILCNDCERKGTTRFHWLYHKCGSCGSYNT 1238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 30/75 (40%)
RING 311..357 CDD:238093 18/45 (40%)
zinc_ribbon_6 358..416 CDD:291274 22/58 (38%)
BTSNP_188457.1 Hr-like 57..183 CDD:213983
Hr-like 316..445 CDD:213983
Hr-like 666..824 CDD:213983
zf-CHY 1006..1082 CDD:283213 30/75 (40%)
zf-DHHC 1071..>1125 CDD:303066 25/57 (44%)
zf-RING_2 1134..1176 CDD:290367 17/42 (40%)
zinc_ribbon_6 1181..1239 CDD:291274 22/58 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2987
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101709
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.670

Return to query results.
Submit another query.