DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and Rchy1

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_080833.1 Gene:Rchy1 / 68098 MGIID:1915348 Length:261 Species:Mus musculus


Alignment Length:241 Identity:118/241 - (48%)
Similarity:155/241 - (64%) Gaps:3/241 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GCAHYKRRAMFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQCLNCGVRFG 247
            ||.||.|..:...|||:|.|.||.|||.||.|..||..:.|:.|..|...|..::.|.:|...||
Mouse    19 GCEHYDRACLLKAPCCDKLYTCRLCHDTNEDHQLDRFKVKEVQCINCEKLQHAQQTCEDCSTLFG 83

  Fly   248 KYTCLICNLFDDADKQQYHCHGCGICRIGGAENFFHCEVCNMCLPIQLKIDGHRCVENISRSHCP 312
            :|.|.||:|| |.||:||||..|||||||..|:||||..||:||...|: ..|:|:||:||.:||
Mouse    84 EYYCSICHLF-DKDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLR-GKHKCIENVSRQNCP 146

  Fly   313 VCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWVYLDDQAERMPVP 377
            :||.||||||:..|:..||||||:.|::::|..| |.||.|..|.:|||..|..||.:..:.|:|
Mouse   147 ICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG-YRCPLCMHSALDMTRYWRQLDTEVAQTPMP 210

  Fly   378 LKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNTTQDVKRRL 423
            .:|:|..|.|.||||:..|..:||.:|:||..|.:|||.|...||:
Mouse   211 SEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGGRRV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 31/72 (43%)
RING 311..357 CDD:238093 24/45 (53%)
zinc_ribbon_6 358..416 CDD:291274 25/57 (44%)
Rchy1NP_080833.1 zf-CHY 20..93 CDD:283213 31/72 (43%)
zf-RING_2 144..186 CDD:290367 22/41 (54%)
zinc_ribbon_6 191..249 CDD:291274 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849605
Domainoid 1 1.000 82 1.000 Domainoid score I8445
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22894
Inparanoid 1 1.050 277 1.000 Inparanoid score I2920
Isobase 1 0.950 - 0 Normalized mean entropy S4176
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - oto94016
orthoMCL 1 0.900 - - OOG6_101709
Panther 1 1.100 - - LDO PTHR21319
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1810
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.