DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and rchy1

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_012816916.1 Gene:rchy1 / 496979 XenbaseID:XB-GENE-956534 Length:268 Species:Xenopus tropicalis


Alignment Length:258 Identity:119/258 - (46%)
Similarity:153/258 - (59%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PTTPESLRFGCAHYKRRAMFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQ 238
            |:....:..||.||.|......|||.|||.||.|||..|:|..||..:|::.|.:|...|..::.
 Frog     6 PSEDMEVTGGCEHYSRGCQLRAPCCGKFYTCRLCHDSKESHKMDRFNVTQVQCMKCKFVQKAQQT 70

  Fly   239 CLNCGVRFGKYTCLICNLFDDADKQQYHCHGCGICRIGGAENFFHCEVCNMCLPIQLKIDGHRCV 303
            |..|...||.|.|.||:|| |.||:||||.||||||||..|.|.||..||:|||:.|: ..|:|:
 Frog    71 CEQCHAVFGDYYCNICHLF-DKDKKQYHCDGCGICRIGPKEEFEHCTKCNLCLPLSLR-GNHKCI 133

  Fly   304 ENISRSHCPVCLGDIHTSRIPCHIPDCGHLLHKM-----------CFDQLLASGHYTCPTCQTSL 357
            ||:||..||:||.||||||:...:..||||||.:           |::.:|..| |.||.|..|.
 Frog   134 ENVSRQDCPICLEDIHTSRVGARVLPCGHLLHSVIQHIRQVIVSTCYEDMLKQG-YRCPLCMRSA 197

  Fly   358 IDMTALWVYLDDQAERMPVPLKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNTTQDVK 420
            :|||..|..|||:..:.|:|.:|:|..|.|.||||...|...||.:|:||..|.:|||.|:.|
 Frog   198 LDMTRYWRQLDDEVAQTPMPSEYQNMTVEILCNDCSSRSTVPFHILGMKCESCSSYNTAQEGK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 31/72 (43%)
RING 311..357 CDD:238093 23/56 (41%)
zinc_ribbon_6 358..416 CDD:291274 26/57 (46%)
rchy1XP_012816916.1 zf-CHY 16..89 CDD:283213 31/72 (43%)
zinc_ribbon_6 198..256 CDD:291274 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5367
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22894
Inparanoid 1 1.050 271 1.000 Inparanoid score I2933
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - oto104237
Panther 1 1.100 - - LDO PTHR21319
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.150

Return to query results.
Submit another query.