DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and rchy1

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_997765.1 Gene:rchy1 / 321875 ZFINID:ZDB-GENE-040801-73 Length:264 Species:Danio rerio


Alignment Length:238 Identity:121/238 - (50%)
Similarity:155/238 - (65%) Gaps:2/238 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 RFGCAHYKRRAMFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQCLNCGVR 245
            :.||.||.|..:...|||.|||.||.|||..|||..||..:.|:.|:.|||.|..::.|..|.|:
Zfish     5 KVGCEHYVRSCLLKAPCCGKFYVCRLCHDAEETHQMDRFKVQEVKCAVCNTIQEAQQICKECEVK 69

  Fly   246 FGKYTCLICNLFDDADKQQYHCHGCGICRIGGAENFFHCEVCNMCLPIQLKIDGHRCVENISRSH 310
            ||:|.|.||:|| |.||:||||..|||||||..|.:|||..||:||..:|| |.|:||||:||.:
Zfish    70 FGEYYCDICHLF-DKDKKQYHCQPCGICRIGPREKYFHCTKCNLCLGTELK-DKHKCVENVSRQN 132

  Fly   311 CPVCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWVYLDDQAERMP 375
            ||||:.||||.|:..|:..||||||..|||.:|.:|.|.||.|..|..:|...|..:|::..:.|
Zfish   133 CPVCMEDIHTFRVGAHVLPCGHLLHGTCFDDMLKTGAYRCPLCMHSAFNMKEYWKQMDEEISQTP 197

  Fly   376 VPLKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNTTQD 418
            :|.:|::..|.|.||||...|...||.:|:||..||:|||.||
Zfish   198 MPTEYQDSTVKIICNDCQARSTVSFHVLGMKCSSCGSYNTAQD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 35/72 (49%)
RING 311..357 CDD:238093 25/45 (56%)
zinc_ribbon_6 358..416 CDD:291274 22/57 (39%)
rchy1NP_997765.1 zf-CHY 8..81 CDD:283213 35/72 (49%)
RING 133..175 CDD:238093 24/41 (59%)
zinc_ribbon_6 180..238 CDD:291274 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595348
Domainoid 1 1.000 89 1.000 Domainoid score I7850
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22894
Inparanoid 1 1.050 290 1.000 Inparanoid score I2788
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - oto40785
orthoMCL 1 0.900 - - OOG6_101709
Panther 1 1.100 - - LDO PTHR21319
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1810
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.