DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and Rchy1

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001007619.1 Gene:Rchy1 / 289508 RGDID:1359180 Length:261 Species:Rattus norvegicus


Alignment Length:247 Identity:119/247 - (48%)
Similarity:159/247 - (64%) Gaps:5/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GCAHYKRRAMFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQCLNCGVRFG 247
            ||.||.|..:...|||:|.|.||.|||.:|.|..||..:.|:.|..|...|..::.|.:|...||
  Rat    19 GCEHYDRACLLKAPCCDKLYTCRLCHDTHEDHQLDRFKVKEVQCINCEKLQHAQQTCEDCSTLFG 83

  Fly   248 KYTCLICNLFDDADKQQYHCHGCGICRIGGAENFFHCEVCNMCLPIQLKIDGHRCVENISRSHCP 312
            :|.|.||:|| |.||:||||..|||||||..|:||||..||:||.:.|: ..|:|:||:||.:||
  Rat    84 EYYCSICHLF-DKDKKQYHCESCGICRIGPKEDFFHCLKCNLCLAMTLR-GKHKCIENVSRQNCP 146

  Fly   313 VCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWVYLDDQAERMPVP 377
            :||.||||||:..|:..||||||:.|::::|..| |.||.|..|.:|||..|..||.:..:.|:|
  Rat   147 ICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG-YRCPLCMHSALDMTRYWRQLDIEVAQTPMP 210

  Fly   378 LKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNTTQDVKRRLSLVTDE 429
            .:|:|..|.|.||||:..|..:||.:|:||..|.:|||.|...|.:|:  ||
  Rat   211 SEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGGRTVSM--DE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 30/72 (42%)
RING 311..357 CDD:238093 24/45 (53%)
zinc_ribbon_6 358..416 CDD:291274 25/57 (44%)
Rchy1NP_001007619.1 zf-CHY 20..93 CDD:283213 30/72 (42%)
zf-RING_2 144..186 CDD:290367 22/41 (54%)
zinc_ribbon_6 191..249 CDD:291274 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8347
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22894
Inparanoid 1 1.050 274 1.000 Inparanoid score I2905
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - oto97546
orthoMCL 1 0.900 - - OOG6_101709
Panther 1 1.100 - - LDO PTHR21319
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.