DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and RCHY1

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_056251.2 Gene:RCHY1 / 25898 HGNCID:17479 Length:261 Species:Homo sapiens


Alignment Length:243 Identity:121/243 - (49%)
Similarity:158/243 - (65%) Gaps:3/243 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GCAHYKRRAMFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQCLNCGVRFG 247
            ||.||.|..:...|||:|.|.||.|||.||.|..||..:.|:.|..|...|..::.|..|...||
Human    19 GCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFG 83

  Fly   248 KYTCLICNLFDDADKQQYHCHGCGICRIGGAENFFHCEVCNMCLPIQLKIDGHRCVENISRSHCP 312
            :|.|.||:|| |.||:||||..|||||||..|:||||..||:||.:.|: ..|:|:||:||.:||
Human    84 EYYCDICHLF-DKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQ-GRHKCIENVSRQNCP 146

  Fly   313 VCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWVYLDDQAERMPVP 377
            :||.||||||:..|:..||||||:.|::::|..| |.||.|..|.:|||..|..|||:..:.|:|
Human   147 ICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG-YRCPLCMHSALDMTRYWRQLDDEVAQTPMP 210

  Fly   378 LKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNTTQDVKRRLSL 425
            .:|:|..|.|.||||:..|..:||.:|:||..|.:|||.|...||:||
Human   211 SEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 31/72 (43%)
RING 311..357 CDD:238093 24/45 (53%)
zinc_ribbon_6 358..416 CDD:291274 26/57 (46%)
RCHY1NP_056251.2 zf-CHY 20..93 CDD:398899 31/72 (43%)
RING-H2_Pirh2 144..187 CDD:319378 23/43 (53%)
zinc_ribbon_6 191..249 CDD:405307 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159236
Domainoid 1 1.000 81 1.000 Domainoid score I8543
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22894
Inparanoid 1 1.050 282 1.000 Inparanoid score I2886
Isobase 1 0.950 - 0 Normalized mean entropy S4176
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - oto90432
orthoMCL 1 0.900 - - OOG6_101709
Panther 1 1.100 - - LDO PTHR21319
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1699
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.