DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and SPAC2F3.16

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_594394.1 Gene:SPAC2F3.16 / 2541608 PomBaseID:SPAC2F3.16 Length:425 Species:Schizosaccharomyces pombe


Alignment Length:236 Identity:88/236 - (37%)
Similarity:133/236 - (56%) Gaps:5/236 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 GCAHYKRRAMFVTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQCLNCGVRFG 247
            ||:||.|........|:::|.||.||::...|..:|..:..::|..|:..|...:.|..|....|
pombe   141 GCSHYMRNCKVQCFDCHEWYTCRHCHNDACDHVLERPAVENMLCMICSKVQPAAQYCKYCKNCMG 205

  Fly   248 KYTCLICNLF-DDADKQQYHCHGCGICRIGG--AENFFHCEVCNMCLPIQLKIDGHRCVENISRS 309
            :|.|..|.|: ||.:|..|||..|||||||.  .:::|||:.|.:||||.: .:.|||:|..:..
pombe   206 RYYCNKCKLWDDDPNKSSYHCDDCGICRIGRGLGDDYFHCKTCGLCLPISV-FNTHRCIERSTDC 269

  Fly   310 HCPVCLGDIHTSRIPCHIPDCGHLLHKMCFDQLLASGHYTCPTCQTSLIDMTALWVYLDDQAERM 374
            :||:|...:..||.......|.|.||:.|.::.:.: :|.||||..::|::.:|:..||.:.||.
pombe   270 NCPICGEYMFNSRERVIFLSCSHPLHQRCHEEYIRT-NYRCPTCYKTIINVNSLFRILDMEIERQ 333

  Fly   375 PVPLKYENQRVHIFCNDCHKTSKTKFHFIGLKCVHCGAYNT 415
            |:|..|......|.||||:....||:||:|.||..|.:|||
pombe   334 PMPYPYNTWISTIRCNDCNSRCDTKYHFLGHKCNSCHSYNT 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 21/72 (29%)
RING 311..357 CDD:238093 15/45 (33%)
zinc_ribbon_6 358..416 CDD:291274 25/58 (43%)
SPAC2F3.16NP_594394.1 zf-CHY 142..215 CDD:283213 21/72 (29%)
zf-RING_2 270..312 CDD:290367 13/42 (31%)
zinc_ribbon_6 317..375 CDD:291274 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I3206
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I1052
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002942
OrthoInspector 1 1.000 - - oto101492
orthoMCL 1 0.900 - - OOG6_101709
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1810
SonicParanoid 1 1.000 - - X1699
TreeFam 1 0.960 - -
109.750

Return to query results.
Submit another query.