DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rchy1 and SPBC18H10.09

DIOPT Version :9

Sequence 1:NP_001260133.1 Gene:Rchy1 / 33901 FlyBaseID:FBgn0031816 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_595733.2 Gene:SPBC18H10.09 / 2540839 PomBaseID:SPBC18H10.09 Length:495 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:41/182 - (22%)
Similarity:61/182 - (33%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QLIVTPTTMTGKYHPAHAKL-----RRCKSTPSLNCDGMAEPME--EDQLHRF------------ 130
            :|:..|    |..||.:|:|     ..|.....:..|.....||  ::|:..|            
pombe   281 RLVWVP----GVIHPNNARLGILHTLGCVPVDVMPIDCQVSCMECVDEQITSFKGISSMQPMLQF 341

  Fly   131 -AACSRNPAAEAQQHAQPSCNSSSSSSDGSCNSNKCSSNICGAQPTTPESLRFGCAHYKRR-AMF 193
             ..|......|.|...........||..|..::.|............|......|.|||:. ..|
pombe   342 CKVCKNRILVEHQDTEFHLLKQRQSSMGGKVSAKKKQKQNLNITKGLPLPNNGACEHYKKSFRWF 406

  Fly   194 VTPCCNKFYKCRFCHDENETHHFDRKTLTELICSECNTRQTVREQ--CLNCG 243
            ...||::.|.|..|||.::.|.|:.  ...:||..|......::.  |.:||
pombe   407 RFSCCDRVYPCDECHDADQNHTFEH--ANRIICGYCAMESFYKKDATCPHCG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rchy1NP_001260133.1 zf-CHY 184..257 CDD:283213 20/63 (32%)
RING 311..357 CDD:238093
zinc_ribbon_6 358..416 CDD:291274
SPBC18H10.09NP_595733.2 zf-CHY 396..457 CDD:283213 20/63 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1940
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.