DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frj and MBOAT4

DIOPT Version :9

Sequence 1:NP_609029.1 Gene:frj / 33900 FlyBaseID:FBgn0031815 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001094386.1 Gene:MBOAT4 / 619373 HGNCID:32311 Length:435 Species:Homo sapiens


Alignment Length:211 Identity:47/211 - (22%)
Similarity:78/211 - (36%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 YRLLY-VWPTFFTFRARIYTGLTLSECVCTMAGFGAYPDESDPNNGEGPRKRYQHLKRDADKHTY 304
            :..:| ||.|...|:...|:...|.:.:...||||....:|....|..|         |||    
Human   238 FECIYVVWTTAGLFKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVP---------DAD---- 289

  Fly   305 NFTTIVNTRVLEVERCWTFREGMKHWNVCVQYWLAVNVYKLFPSKKYRTGATLLCSAYWHGFRPG 369
                     :..:||........:.||.....||...|::  .|:.:....|...||:|||..||
Human   290 ---------IWTLERTHRISVFSRKWNQSTARWLRRLVFQ--HSRAWPLLQTFAFSAWWHGLHPG 343

  Fly   370 HYF-----CIMGAPFYVSLEDMWDKLVRKSATGTSRRVIDVIFWIFKWFAFSYLGEAFLLSSFGN 429
            ..|     .:|....|: :....::.:|   :...|.....:.|.......:|:..|..:.|..:
Human   344 QVFGFVCWAVMVEADYL-IHSFANEFIR---SWPMRLFYRTLTWAHTQLIIAYIMLAVEVRSLSS 404

  Fly   430 IW---RFYSSVYHIGY 442
            :|   ..|:||:.:.|
Human   405 LWLLCNSYNSVFPMVY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frjNP_609029.1 MBOAT 93..427 CDD:281107 41/191 (21%)
MBOAT4NP_001094386.1 MBOAT 18..427 CDD:294479 47/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D881262at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.