DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frj and Lpcat3

DIOPT Version :9

Sequence 1:NP_609029.1 Gene:frj / 33900 FlyBaseID:FBgn0031815 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001012189.1 Gene:Lpcat3 / 362434 RGDID:1310223 Length:487 Species:Rattus norvegicus


Alignment Length:452 Identity:102/452 - (22%)
Similarity:175/452 - (38%) Gaps:86/452 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HSLHCFVSLALGTAAVLLVHPSKGHLVTFAVMFGYLVF---FRIFDFYFGIPGHTN----MIQMI 107
            |||.|.|       ...|:....|..:|  .:|..|.|   :.:..:|:...|..:    |...:
  Rat    92 HSLLCVV-------LQFLILRLMGRTIT--AVFTTLCFQMAYLLAGYYYTATGDYDIKWTMPHCV 147

  Fly   108 LTLKVSGIAFEKTAAWK-RLQAHDEQKKNDQRDVHQESPIEITDYDVELQSLSAAEILHYSFNYI 171
            ||||:.|::.:.....| |.....||:|                |.: |...|..|:..:|:.|.
  Rat   148 LTLKLIGLSIDYYDGGKDRNSLSSEQQK----------------YAI-LGVPSLLEVAGFSYFYG 195

  Fly   172 GVLTGPYYRYRTYR-----DYFEMPFKTYAPTVEATLEKLKYAVFYCALYLATNYMWPLDYALSD 231
            ..|.||.:....|.     ...::|.|....|:.| |::|...:.|...|...:.....||.|::
  Rat   196 AFLVGPQFSMNHYMKLVKGQLTDVPGKMPNSTIPA-LKRLSLGLVYLVGYTLLSPHITEDYLLTE 259

  Fly   232 EFFNDRSFVYRLLY--VWPTFFTFRARIYTGLTLSECVCTMAGFGAYPDESDPNNGEGPRKRYQH 294
            : ::.|.|.:|.:|  :|..|..:  :..|...::|.||.::|.|....|   .||         
  Rat   260 D-YDTRPFWFRCMYMLIWGKFVLY--KYVTCWLVTEGVCILSGLGFNGFE---ENG--------- 309

  Fly   295 LKRDADKHTYNFTTIVNTRVLEVERCWTFREGMKHWNVCVQYWLAVNVY---KLFPSKKYRTGAT 356
                    |..:....|.:|...|....|...:..:|:....|:|..::   |...:|:...|.:
  Rat   310 --------TVKWDACANMKVWLFETTPRFTGTIASFNINTNAWVARYIFKRLKFLGNKELSQGLS 366

  Fly   357 LLCSAYWHGFRPGHYFCIMGAPFYVSLEDMWDKLVRKSATGTSRRVI-----------DVIFWIF 410
            ||..|.|||...|:..|.......|.:|.....|:|.|...:|...|           ..|.|:|
  Rat   367 LLFLALWHGLHSGYLICFQMEFLIVIVEKQATNLIRDSPALSSLASITALQPFYYLVQQTIHWLF 431

  Fly   411 KWFAFSYLGEAFLLSSFGNIWRFYSSVYHIGYISWAAMTALGFYLTSQRKAAERRKKRAAEK 472
            ..::.:    ||.|.::....:.|.|:|.:|::.:.::.   |.|....||...||::..::
  Rat   432 MGYSMT----AFCLFTWDKWLKVYRSIYFLGHVFFLSLL---FTLPYVYKAMVPRKEKLKKR 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frjNP_609029.1 MBOAT 93..427 CDD:281107 81/359 (23%)
Lpcat3NP_001012189.1 MBOAT 126..437 CDD:281107 78/351 (22%)
Di-lysine motif 484..487 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D881262at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.