DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frj and Mboat7

DIOPT Version :9

Sequence 1:NP_609029.1 Gene:frj / 33900 FlyBaseID:FBgn0031815 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001128450.2 Gene:Mboat7 / 308309 RGDID:1306945 Length:473 Species:Rattus norvegicus


Alignment Length:486 Identity:155/486 - (31%)
Similarity:246/486 - (50%) Gaps:31/486 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSIDDVIYVICLLGCIGAGSYVKKIADEGQRKLVSTGLGVLVVVIVSGLHSLHCFVSLALGTAAV 65
            |:.::..|::.||..|..|...|| |..|.::..:..:|:.:.:...|.||||..::: |||.|:
  Rat     1 MTPEEWTYLMVLLISIPVGFLFKK-AGPGLKRWGAAAVGLGLTLFTCGPHSLHSLITI-LGTWAL 63

  Fly    66 LLVHPSKGHLVTFAVMFGYLVFFRIFDFYFGIP---GHTNMIQMILTLKVSGIAFEKTAAWKRLQ 127
            :...|...|.:..|..|.||:|||.... .|:|   ..||.:|::||||:..:|.|..      .
  Rat    64 IQAQPCSCHALALAWTFSYLLFFRALSL-LGLPTPTPFTNAVQLLLTLKLVSLASEVQ------D 121

  Fly   128 AHDEQKKNDQRDVHQESPIEITDYDVELQSLSAAEILHYSFNYIGVLTGPYYRYRTYRDYFEMPF 192
            .|..|:|.......:|..:.:.. ||.    |..|.|.||:.|:|::|||::|||||.|:.|.||
  Rat   122 LHLAQRKEMASGFSKEPTLGLLP-DVP----SLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPF 181

  Fly   193 KTYAPTVEATLEKLKYAVFYCALYLATNYMWPLDYALSDEFFNDRSFVYRLLYVWPTFFTFRARI 257
            ....|::...|.:...|..:..|:|.:::::||: |:.::.|..|....||.|:.|.||.||.|.
  Rat   182 PEAVPSLRPLLRRAWPAPLFGLLFLLSSHLFPLE-AVREDAFYARPLPTRLFYMIPVFFAFRMRF 245

  Fly   258 YTGLTLSECVCTMAGFGAYPDESDPNNGEGPRKRY--QHLKRDADKHTYNFTTIVNTRVLEVERC 320
            |.....:||.|..|||||||..:....|.||..:.  ......|....|::..|.|......:.|
  Rat   246 YVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQCPPPSSPEIAASLEYDYEAIRNIDCYGTDFC 310

  Fly   321 WTFREGMKHWNVCVQYWLAVNVYKLFPSKKY--RTGATLLCSAYWHGFRPGHYFCIMGAPFYVSL 383
            ...|:||::||:.||:|||..:||..|.:.|  |:..|:|.||||||..||:|...|..|..::.
  Rat   311 VRVRDGMRYWNMTVQWWLAQYIYKSAPFRSYVLRSAWTMLLSAYWHGLHPGYYLSFMTIPLCLAA 375

  Fly   384 EDMWDKLVRKSATGTSRRVIDVIFWIFKWFAFSYLGEAFLLSSFGNIWRFYSSVYHIGYISWAAM 448
            |...:..:|:..:...::..|...|..|..|:.|:...|:|.|.|:..|:::|:|.  ::.:.|:
  Rat   376 EGYLESALRRHLSPGGQKAWDWFHWFLKMRAYDYMCMGFVLLSMGDTLRYWASIYF--WVHFLAL 438

  Fly   449 TALGFYLT------SQRKA-AERRKKRAAEK 472
            ..||..|.      |:||. ::....:|.||
  Rat   439 ACLGLGLALGGGSPSKRKTPSQATTSQAKEK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frjNP_609029.1 MBOAT 93..427 CDD:281107 111/340 (33%)
Mboat7NP_001128450.2 MBOAT 8..431 CDD:382173 143/437 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11510
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475957at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.