DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frj and Mboat1

DIOPT Version :9

Sequence 1:NP_609029.1 Gene:frj / 33900 FlyBaseID:FBgn0031815 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_705774.1 Gene:Mboat1 / 218121 MGIID:2387184 Length:492 Species:Mus musculus


Alignment Length:485 Identity:115/485 - (23%)
Similarity:196/485 - (40%) Gaps:100/485 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IDDVIYVICLLGCIGAGSYVKKIADEGQ-----RKLVSTGLGVLVVVIVSGLHSLHCFVSLALGT 62
            :|.|.:|.|.|..:.|..:.:.....|:     |..::|.||:..||...|.:::|.||.:.:..
Mouse    30 LDQVNFVACQLFALSAAFWFRIYLHPGKASPEVRHTLATILGIYFVVFCFGWYAVHLFVLVLMCY 94

  Fly    63 AAVLLVHPSKGHLVTFAVMFGYLV---FFRIFDFYFGI-------PGHTNMIQMILTLKVSGIAF 117
            ..::....|..|..:|.|..|||.   ..||:.|::||       |      .||:|.|::.:||
Mouse    95 GVMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSGP------LMIVTQKITTLAF 153

  Fly   118 EKTAAWKRLQAHDEQKKNDQRDVHQESPIEITDYDVELQSL------SAAEILHYSFNYIGVLTG 176
                     |.||...:..:            |...|...|      |..|.|.|..|::.|:.|
Mouse   154 ---------QVHDGLGRKAE------------DLSAEQHRLAVKAKPSLLEYLSYHLNFMSVIAG 197

  Fly   177 PYYRYRTY--------------------RDYFEMPFKTYAPT-VEATLEKLKYAVFYCALYLATN 220
            |...::.|                    |.:..:|    .|: :.|.::||...:....|:|..:
Mouse   198 PCNNFKDYVAFIEGRHIHMKLLEVNWTQRGFQSLP----EPSPMGAVIQKLCVTLMSLLLFLTLS 258

  Fly   221 YMWPLDYALSDEFFNDRSFVYRLLYVWPTFFTFRARIYTGLTLSECVCTMAGFGAYPDESDPNNG 285
            ..:|:.:.:.|.|.:..:|:.||.|::......:.:.|...||::.|...||||.        ||
Mouse   259 KSFPVTFLIDDWFVHKANFLSRLWYLYVVMQAAKPKYYFAWTLADAVHNAAGFGF--------NG 315

  Fly   286 EGPRKRYQHLKRDADKHTYNFTTIVNTRVLEVERCWTFREGMKHWNVCVQYWLAVNVYKLFPSKK 350
                       .|.|..: .:..:.|..:.::|...:|:..:::||:....||....|:..|  .
Mouse   316 -----------MDTDGKS-RWDLLSNLNIWKIETATSFKMYLENWNIQTSTWLKCVCYERVP--W 366

  Fly   351 YRTGATLLCSAYWHGFRPGHYFCIM-GAPFYVSLEDMWDKLVRKSATGTSRRV-IDVIFWIFKWF 413
            |.|..|.|.||.|||..||:||..: |.|..::...:.:.......:..:|:: .||:.|.....
Mouse   367 YPTVLTFLLSALWHGVYPGYYFTFLTGVPVTLAARAVRNNYRHHFLSSKARKIAYDVVTWAVTQL 431

  Fly   414 AFSYLGEAFLLSSFGNIWRFYSSVY---HI 440
            |.||....|::.:.......|.||:   ||
Mouse   432 AVSYTAAPFVMLAVEPTISLYKSVFFFLHI 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frjNP_609029.1 MBOAT 93..427 CDD:281107 84/369 (23%)
Mboat1NP_705774.1 MBOAT 21..458 CDD:294479 113/480 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D881262at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.