DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frj and Lpcat3

DIOPT Version :9

Sequence 1:NP_609029.1 Gene:frj / 33900 FlyBaseID:FBgn0031815 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_660112.1 Gene:Lpcat3 / 14792 MGIID:1315211 Length:487 Species:Mus musculus


Alignment Length:454 Identity:104/454 - (22%)
Similarity:173/454 - (38%) Gaps:90/454 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HSLHC----FVSLALGTAAVLLVHPSKGHLVTFAVMFGYLVFFRIFDFYFGIPGHTN----MIQM 106
            |||.|    |:.|.|....|..|      :.|......||    :..:|:...|..:    |...
Mouse    92 HSLLCVVLQFLILRLMGRTVTAV------ITTLCFQMAYL----LAGYYYTATGDYDIKWTMPHC 146

  Fly   107 ILTLKVSGIAFEKTAAWKRLQA-HDEQKKNDQRDVHQESPIEITDYDVELQSLSAAEILHYSFNY 170
            :||||:.|:..:.....|...: ..||:|...|.|.                 |..|:..:|:.|
Mouse   147 VLTLKLIGLCIDYYDGGKDGNSLTSEQQKYAIRGVP-----------------SLLEVAGFSYFY 194

  Fly   171 IGVLTGPYYRYRTYR-----DYFEMPFKTYAPTVEATLEKLKYAVFYCALYLATNYMWPLDYALS 230
            ...|.||.:....|.     ...::|.|....|:.| |::|...:.|...|...:.....||.|:
Mouse   195 GAFLVGPQFSMNHYMKLVRGQLTDIPGKMPNSTIPA-LKRLSLGLVYLVGYTLLSPHITDDYLLT 258

  Fly   231 DEFFNDRSFVYRLLY--VWPTFFTFRARIYTGLTLSECVCTMAGFGAYP-DESDPNNGEGPRKRY 292
            :::.| |.|.:|.:|  :|..|..:  :..|...::|.||.::|.|... ||    ||       
Mouse   259 EDYDN-RPFWFRCMYMLIWGKFVLY--KYVTCWLVTEGVCILSGLGFNGFDE----NG------- 309

  Fly   293 QHLKRDADKHTYNFTTIVNTRVLEVERCWTFREGMKHWNVCVQYWLAVNVY---KLFPSKKYRTG 354
                      |..:....|.:|...|....|...:..:|:....|:|..::   |...:|:...|
Mouse   310 ----------TVRWDACANMKVWLFETTPRFNGTIASFNINTNAWVARYIFKRLKFLGNKELSQG 364

  Fly   355 ATLLCSAYWHGFRPGHYFCIMGAPFYVSLEDMWDKLVRKSATGTSRRVI-----------DVIFW 408
            .:||..|.|||...|:..|.......|.:|.....|:|.|...:|...|           ..|.|
Mouse   365 LSLLFLALWHGLHSGYLICFQMEFLIVIVEKQVSSLIRDSPALSSLASITALQPFYYLVQQTIHW 429

  Fly   409 IFKWFAFSYLGEAFLLSSFGNIWRFYSSVYHIGYISWAAMTALGFYLTSQRKAAERRKKRAAEK 472
            :|..::.:    ||.|.::....:.|.|:|.:|::.:.::.   |.|....||...||::..::
Mouse   430 LFMGYSMT----AFCLFTWDKWLKVYRSIYFLGHVFFLSLL---FILPYIHKAMVPRKEKLKKR 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frjNP_609029.1 MBOAT 93..427 CDD:281107 82/360 (23%)
Lpcat3NP_660112.1 MBOAT 126..437 CDD:281107 79/352 (22%)
Di-lysine motif 484..487 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.