DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frj and lpcat3

DIOPT Version :9

Sequence 1:NP_609029.1 Gene:frj / 33900 FlyBaseID:FBgn0031815 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_002941254.1 Gene:lpcat3 / 100498491 XenbaseID:XB-GENE-950240 Length:467 Species:Xenopus tropicalis


Alignment Length:484 Identity:116/484 - (23%)
Similarity:190/484 - (39%) Gaps:104/484 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TGLGVLVVVIVSGL-HSLHC----FVSLALGTAAVLLVHPSKGHLVTFAVMFGYLVFFRIFDFYF 95
            ||||:......|.| |||.|    |:.|.|....:..|..|      |.:..|||    :..:|:
 Frog    58 TGLGIAYFNFGSQLYHSLLCVVLNFLILRLMGRTMTAVFTS------FCLQMGYL----LCGYYY 112

  Fly    96 GIPGHTN----MIQMILTLKVSGIAFEKTAAWKRLQAHDEQKKNDQRDVHQESPIEITDYDVE-L 155
            ....:.:    |...:||||:.|:.|:         .:|..|  |:..:.:|.    ..|.|. :
 Frog   113 TATDNYDIKWTMPHCVLTLKLIGLTFD---------YYDSSK--DKESMTEEQ----MRYAVPGV 162

  Fly   156 QSLSAAEILHYSFNYIGVLTGPYYRYRTY-----RDYFEMPFKTYAPTVEATLEKLKYAVFYCAL 215
            .||  .|:..:|:.|.|.|.||.:...:|     .:..::|.:. ..::|..:::|...:|...:
 Frog   163 PSL--MEVCGFSYYYGGFLVGPQFSMCSYLKLVRGELTDVPGQR-PNSIEPAMKRLSLGLFCLVI 224

  Fly   216 YLATNYMWPLDYALSDEFFNDRSFVYRLLYV--WPTFFTFRARIYTGLT---LSECVCTMAGFGA 275
            |.....|.|..|.|:||:.| :.|.||..||  |.     :..:|..:|   ::|.||.::|.| 
 Frog   225 YTVFGPMLPDSYFLTDEYAN-KPFWYRCAYVPIWG-----KVMLYKYVTCWLVTEGVCILSGLG- 282

  Fly   276 YPDESDPNNGEGPRKRYQHLKRDADKHTYNFTTIVNTRVLEVERCWTFREGMKHWNVCVQYWLAV 340
                   .||:....|   ::.||         ..|.:|.:.|....|...:..:|:....|:|.
 Frog   283 -------YNGKDDTGR---VRWDA---------CANMKVWQYETTPLFTGTIASFNINTNAWVAR 328

  Fly   341 NVYK---LFPSKKYRTGATLLCSAYWHGFRPGHYFCIMGAPFYVSLEDMWDKLVRK-------SA 395
            .|:|   ...:|.......|...|.|||...|::.|.......|.:|.....|:|.       |:
 Frog   329 YVFKRLRFLGNKAISQATALFFLAIWHGLHSGYFVCFSLEFLIVIVERQAMDLIRDSPLLSQISS 393

  Fly   396 TGTSRRVIDVIFWIFKWFAFSYLGEAFLLSSFGNIWRFYSSVYHIGYISWAAMTALGFYLTSQRK 460
            ....|.:|.|:.....|....|....|.|.::....:.|||||.:|::.:..:.   |.|...|:
 Frog   394 IPILRPIIYVVQQCIHWLFMGYPLVPFCLFTWDKWLKVYSSVYFVGHLFFLLLL---FALPYLRR 455

  Fly   461 AAERRKKRAAEKAAGGDGIAAAIEKEKAQ 489
            ....||                 :|:|:|
 Frog   456 VLVPRK-----------------DKQKSQ 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frjNP_609029.1 MBOAT 93..427 CDD:281107 83/358 (23%)
lpcat3XP_002941254.1 MBOAT 11..440 CDD:382173 107/435 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D881262at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.