DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frj and mboat1

DIOPT Version :9

Sequence 1:NP_609029.1 Gene:frj / 33900 FlyBaseID:FBgn0031815 Length:489 Species:Drosophila melanogaster
Sequence 2:XP_002940346.1 Gene:mboat1 / 100495384 XenbaseID:XB-GENE-994274 Length:503 Species:Xenopus tropicalis


Alignment Length:526 Identity:122/526 - (23%)
Similarity:202/526 - (38%) Gaps:104/526 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IDDVIYVICLLGCIGAGSYVK-----KIADEGQRKLVSTGLGVLVVVIVSGLHSLHCFVSLALGT 62
            ::.|.:|.|.|..:....:.:     ..|....|...:|.:||...|...|.:|||.|..:.|..
 Frog    29 LEQVNFVACQLVALLVAFWFRIYLNPSNAHPAVRHAFATFVGVYFAVFCFGWYSLHIFTLVLLCY 93

  Fly    63 AAVLLVHPSKGHLVTFAVMFGYLVFF---RIFDFYFGI-------PGHTNMIQMILTLKVSGIAF 117
            ..::....|..|..:|.:..|||...   |::.|.:||       |      .||:|.|::.:||
 Frog    94 CIMITASVSNVHRYSFIMAMGYLTLCQINRVYIFNYGILSTDFSGP------LMIITQKITTLAF 152

  Fly   118 EKTAAWKRLQAHD------EQKKNDQRDVHQESPIEITDYDVELQSLSAAEILHYSFNYIGVLTG 176
                     |.||      :....||:           .|.:: :..|..|.|.|..|::.||.|
 Frog   153 ---------QLHDGFGRSFKVLSKDQQ-----------QYSIK-KKPSFLEYLSYHLNFMSVLAG 196

  Fly   177 PYYRYRTY------------------RDYFEMPFKTYAPTVEATLEKLKYAVFYCALYLATNYMW 223
            |...::.|                  ..|.::|  ..:|. |..:.||..|....|:::.....:
 Frog   197 PCSNFQDYIAFIEGRHIQSKLLNSKGNGYTKLP--NPSPN-EVVIYKLCIAAASLAVFMTFTKAF 258

  Fly   224 PLDYALSDEFFNDRSFVYRLLYVWPTFFTFRARIYTGLTLSECVCTMAGFGAYPDESDPNNGEGP 288
            |:.|.:.:.|.|...|:.||.|.:......:.:.|...||::.|...||:|.        ||.. 
 Frog   259 PILYVVDETFMNTVPFLKRLGYFYIATQACKPKYYFAWTLADAVNNAAGYGF--------NGVD- 314

  Fly   289 RKRYQHLKRDADKHTYNFTTIVNTRVLEVERCWTFREGMKHWNVCVQYWLAVNVYKLFPSKKYRT 353
                       :|..:.:..|.|..:..:|...:|:..:.:||:....||....|...|  ||||
 Frog   315 -----------EKGKFRWDLISNLNIWNIETATSFKMYIDNWNIQTAAWLKRVCYDRAP--KYRT 366

  Fly   354 GATLLCSAYWHGFRPGHYFCIMGA-PFYVSLEDMWDKLVRKSATGTSRRVI-DVIFWIFKWFAFS 416
            |.|.:.|..|||..||:||..:.| |..::...|.:.......|..|.:.: |::.|.....|..
 Frog   367 GLTFILSGVWHGVYPGYYFTFVTAIPVMLAARAMRNNFRHYFTTSASWKFLYDIVTWTATQLAIC 431

  Fly   417 YLGEAFLLSSFGNIWRFYSSVY-HIGYISWAAMTALGFYLTSQRKAAERRKKRAAEKAAGGDGIA 480
            |....|:|.:.|...:.|.|:| ::..:.:..:..|          ..:...||..|..|...|.
 Frog   432 YTVAPFVLLAAGPSVQLYKSLYFYLHIVCFLVLIIL----------PTKPSGRAFSKGHGASEIN 486

  Fly   481 AAIEKE 486
            .:.||:
 Frog   487 HSEEKQ 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frjNP_609029.1 MBOAT 93..427 CDD:281107 87/366 (24%)
mboat1XP_002940346.1 MBOAT 18..480 CDD:382173 118/512 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D881262at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.