DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and SEC14

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:76/264 - (28%)
Similarity:133/264 - (50%) Gaps:10/264 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 DFIARSLGQLSPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWR 272
            |.:..:.|.|...||..|.||||:|:....:||:.. .|:||||.||.:.|..|..|..:..:||
Yeast    20 DALPGTPGNLDSAQEKALAELRKLLEDAGFIERLDD-STLLRFLRARKFDVQLAKEMFENCEKWR 83

  Fly   273 REHRIDALLAE--YSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLAL 335
            :::..|.:|.:  |.:..::.:.:|..:|..||||||||...||.:::..:.|....:.:|:..:
Yeast    84 KDYGTDTILQDFHYDEKPLIAKFYPQYYHKTDKDGRPVYFEELGAVNLHEMNKVTSEERMLKNLV 148

  Fly   336 HICEEGIQKINESAERLEKPVLNWS-LLVDLEGLSMRHLWRPGIKALLNIIETVERN-YPETMGR 398
            ...|..:|....:..|....::..| .::||:|:|:...:  .:.:.:.....:.:| |||.||:
Yeast   149 WEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAY--SVMSYVREASYISQNYYPERMGK 211

  Fly   399 VLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIH 463
            ..::.||..|..|:.:...|:|..|.||....|  .::.|:.|.| :..|.:|...||..:....
Yeast   212 FYIINAPFGFSTAFRLFKPFLDPVTVSKIFILG--SSYQKELLKQ-IPAENLPVKFGGKSEVDES 273

  Fly   464 EGGL 467
            :|||
Yeast   274 KGGL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 19/45 (42%)
CRAL_TRIO 293..456 CDD:279044 43/164 (26%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 19/45 (42%)
SEC14 99..269 CDD:214706 45/174 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I2522
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2121
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 1 1.000 - - mtm9225
orthoMCL 1 0.900 - - OOG6_100867
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1304
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.