DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and SFH5

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:70/310 - (22%)
Similarity:111/310 - (35%) Gaps:96/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 ELRKMLDGV--------DDL------------ERVPSY-------QTILRFLAARDWHVSQAYAM 264
            :|:|.:.|:        |:|            |.|..|       :...:...|..:..|.....
Yeast    14 KLKKAIPGIIKEKCAGYDELYGYKLNPEGLTQEEVDKYYDEKIADRLTYKLCKAYQFEYSTIVQN 78

  Fly   265 LCDSLRWRREHRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRL---GHMDVKGLLKSL- 325
            |.|.|.||||  .:.|...|.:.           |:.:...  |.||..   |..:.|.:..:| 
Yeast    79 LIDILNWRRE--FNPLSCAYKEV-----------HNTELQN--VGILTFDANGDANKKAVTWNLY 128

  Fly   326 -----------GMDGLLRLALHICEEGIQKIN-ESAERLEKPVLNWSLLV-DLEGLSMRHLWR-- 375
                       .:|..:|..:.:.|:|:..:: .|::.      |:...| |.:|:|   :||  
Yeast   129 GQLVKKKELFQNVDKFVRYRIGLMEKGLSLLDFTSSDN------NYMTQVHDYKGVS---VWRMD 184

  Fly   376 PGIKALLNIIETV----ERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAH 436
            ..||   |..:||    ::.|||.:.....|..|.||...:.::..|:||.||.||:.       
Yeast   185 SDIK---NCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVV------- 239

  Fly   437 MKDG--LAQYLDEEIVPDFLGGPCKTMIHEGGLVPKTLYKMNSLEDHDDE 484
            :.||  |.|||.:          |....:.|......|.|.|....|..|
Yeast   240 LTDGSKLGQYLKD----------CPYEGYGGKDKKNNLTKQNVTNVHPTE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 11/67 (16%)
CRAL_TRIO 293..456 CDD:279044 44/187 (24%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 45/192 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.