DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and AT1G55690

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001323358.1 Gene:AT1G55690 / 842018 AraportID:AT1G55690 Length:625 Species:Arabidopsis thaliana


Alignment Length:313 Identity:86/313 - (27%)
Similarity:151/313 - (48%) Gaps:33/313 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 ITHVERWTSPSDATKSPTLDQASDQQHSILLDGDFIARSLGQLSP----------MQESKLLELR 229
            |:..||..|.....|...::.::...||:...|   .|.:....|          .:||.:||.|
plant    22 ISEDERRRSKIGNLKKKAINASTKFTHSLKKRG---KRKIDYRVPAVSIEDVRDEKEESVVLEFR 83

  Fly   230 KMLDGVDDLER--VP----SYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEYSKPA 288
            :.|     |||  :|    .|.|:||||.|||.::.:...:..:.||||:|:..|.:|.::....
plant    84 RKL-----LERDLLPPRHDEYHTLLRFLKARDLNIEKTTQLWEEMLRWRKEYGTDTILEDFDFEE 143

  Fly   289 V--VVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQ-KINESAE 350
            :  |::::|.|:|.:||:||||||.|||......|::...:|..|:..:...|..:| |....:.
plant   144 LEEVLQYYPQGYHGVDKEGRPVYIERLGKAHPSKLMRITTIDRYLKYHVQEFERALQEKFPACSI 208

  Fly   351 RLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERN-YPETMGRVLVVRAPRVF-PIAWT 413
            ..::.:.:.:.::|::||.::: :.|....|:..:..::.: ||||:.|:.:|.|...| .:.|.
plant   209 AAKRRICSTTTILDVQGLGIKN-FTPTAANLVAAMSKIDNSYYPETLHRMYIVNAGTGFKKMLWP 272

  Fly   414 IVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIHEGG 466
            ....|:|..|.:|.....|.....   |.:.:|...:|:||||.|......||
plant   273 AAQKFLDAKTIAKIHVLEPKSLFK---LHEVIDSSQLPEFLGGSCSCFGDGGG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 19/51 (37%)
CRAL_TRIO 293..456 CDD:279044 44/165 (27%)
AT1G55690NP_001323358.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2681
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 1 1.000 - - otm2464
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X399
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.