DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and AT1G01630

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_171669.1 Gene:AT1G01630 / 839231 AraportID:AT1G01630 Length:255 Species:Arabidopsis thaliana


Alignment Length:274 Identity:73/274 - (26%)
Similarity:122/274 - (44%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ASDQQHSILLDGDFIARS----LGQLSPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAARDW 256
            |:.:|.::.|..|.|.||    :..|...|:.:..|       ||||       .|.|||.|||.
plant    12 AAAEQKTVPLIEDEIERSKVGIMRALCDRQDPETKE-------VDDL-------MIRRFLRARDL 62

  Fly   257 HVSQAYAMLCDSLRWRRE-----HRIDALLA-EYSKPAVVVE-HFPGGWHHLDKDGRPVYILRLG 314
            .:.:|..|..:.|.|:|.     |..:|.:| :.|...:.:: |        ||.|||:.: .:|
plant    63 DIEKASTMFLNYLTWKRSMLPKGHIPEAEIANDLSHNKMCMQGH--------DKMGRPIAV-AIG 118

  Fly   315 --HMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPG 377
              |...||     ..|...|..::..|:...::....|:       :..:.||:|....:.   .
plant   119 NRHNPSKG-----NPDEFKRFVVYTLEKICARMPRGQEK-------FVAIGDLQGWGYSNC---D 168

  Fly   378 IKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLA 442
            |:..|..:.|::..|||.:|::.:|.||.:|..||.::..|||.:|:.|.:|.  :...:...|.
plant   169 IRGYLAALSTLQDCYPERLGKLYIVHAPYIFMTAWKVIYPFIDANTKKKIVFV--ENKKLTPTLL 231

  Fly   443 QYLDEEIVPDFLGG 456
            :.:||..:||..||
plant   232 EDIDESQLPDIYGG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 14/45 (31%)
CRAL_TRIO 293..456 CDD:279044 41/164 (25%)
AT1G01630NP_171669.1 CRAL_TRIO_N 29..74 CDD:215024 17/58 (29%)
SEC14 103..246 CDD:238099 43/169 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.