DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and AT5G63060

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_201111.2 Gene:AT5G63060 / 836426 AraportID:AT5G63060 Length:263 Species:Arabidopsis thaliana


Alignment Length:255 Identity:60/255 - (23%)
Similarity:99/255 - (38%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 FIARSLGQLSPMQESKLLELRKMLDGVDDLERVP-------SYQTILRFLAARDWHVSQAYAMLC 266
            |..||....|......:||:::.|  ..|...:|       ....||.||..|.:.|.:|...|.
plant    32 FSVRSCVSESQHAHKLVLEVKERL--AKDCTSLPLGKYGRDDEDMILWFLKDRRFSVDEAIGKLT 94

  Fly   267 DSLRWRREHRIDALLAEYSKPA-----VVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLG 326
            .:::||.|.::|.|..:..|.|     ..|..|      ||..||||.|:... ..:.|||..:.
plant    95 KAIKWRHEFKVDELSEDSIKAATDTGKAYVHGF------LDVKGRPVVIVAPA-KHIPGLLDPIE 152

  Fly   327 MDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERN 391
            .:   :|.:.:.|:.:.|:.....:    :|.   :.||.|...::   ..:|.|..:.:.....
plant   153 DE---KLCVFLLEKALSKLPAGQHK----ILG---IFDLRGFGSQN---ADLKFLTFLFDVFYYY 204

  Fly   392 YPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVP 451
            ||..:..||.|.||.:|...|......:.::. |...|...:...     .:|..||.:|
plant   205 YPSRLDEVLFVDAPFIFQPIWQFTKPLVKQYA-SLVKFCSAETVR-----KEYFTEETLP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 13/52 (25%)
CRAL_TRIO 293..456 CDD:279044 35/159 (22%)
AT5G63060NP_201111.2 SEC14 118..261 CDD:214706 36/167 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.