DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and AT5G47730

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001330995.1 Gene:AT5G47730 / 834824 AraportID:AT5G47730 Length:341 Species:Arabidopsis thaliana


Alignment Length:271 Identity:75/271 - (27%)
Similarity:126/271 - (46%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 MQESKLLELRKMLDGVDD-----LERV-PSY--QTILRFLAARDWHVSQAYAMLCDSLRWRREHR 276
            :.|..:.|.::::|.|::     .||| ..|  :.:.|||.||||:|.:|:.||.:.||||.::.
plant     4 VSEEAIDEFQELMDQVEEPLKKTYERVHQGYLRENLGRFLKARDWNVCKAHTMLVECLRWRVDNE 68

  Fly   277 IDALLAEYSKPAVVVEHFPG-------GWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLA 334
            ||::|   |||.|..|.:..       |.....|:|.||:.:            .:|:....:.:
plant    69 IDSIL---SKPIVPTELYRDVRDSQLIGMSGYTKEGLPVFAI------------GVGLSTFDKAS 118

  Fly   335 LHICEEGIQKINESAERL---------EKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETV-E 389
            :|...:...:|||..:|:         .:|:.....::|:.||.:..|.:  || |:.||.|: :
plant   119 VHYYVQSHIQINEYRDRVLLPSISKKNGRPITTCVKVLDMTGLKLSALSQ--IK-LVTIISTIDD 180

  Fly   390 RNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHM-----KDGLAQYLDEEI 449
            .||||......||.||.:|...|.:|...:.|.||.|        .|:     :|.|.:.:|...
plant   181 LNYPEKTNTYYVVNAPYIFSACWKVVKPLLQERTRKK--------VHVLSGCGRDELLKIMDFTS 237

  Fly   450 VPDFLGGPCKT 460
            :|.|    |::
plant   238 LPHF----CRS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 19/53 (36%)
CRAL_TRIO 293..456 CDD:279044 43/184 (23%)
AT5G47730NP_001330995.1 CRAL_TRIO_N 8..59 CDD:397711 18/50 (36%)
SEC14 91..242 CDD:214706 43/177 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.