DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and SFH3

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001031389.1 Gene:SFH3 / 816693 AraportID:AT2G21540 Length:548 Species:Arabidopsis thaliana


Alignment Length:528 Identity:123/528 - (23%)
Similarity:220/528 - (41%) Gaps:94/528 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SILLDGDFIARSLGQLSPMQESKLLELRKMLDGVDDLERVPS----YQTILRFLAARDWHVSQAY 262
            |:.:..|.....|..:...:::.:|:           |.:||    :..:||||.||.:.:.:|.
plant    58 SVSIVDDIDLEELQAVDAFRQALILD-----------ELLPSKHDDHHMMLRFLRARKFDLEKAK 111

  Fly   263 AMLCDSLRWRREHRIDALLAEYSKPAV--VVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSL 325
            .|..|.:.||:|..:|.::.::....:  |::::|.|:|.:|||||||||.|||.:|...|::..
plant   112 QMWTDMIHWRKEFGVDTIMEDFDFKEIDEVLKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVT 176

  Fly   326 GMDGLLRLALHICEEGIQ-KINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVE 389
            .:|..::..:...|:... |:...:...:|.:...:.::|::|:.::..    .||..::::.::
plant   177 TIDRYVKYHVREFEKTFNIKLPACSIAAKKHIDQSTTILDVQGVGLKSF----SKAARDLLQRIQ 237

  Fly   390 R----NYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIV 450
            :    |||||:.|:.::.|...|.:.|:.|.:|:|..|.:|....|   ...:..|.:.:|...:
plant   238 KIDSDNYPETLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLG---NKYQSKLLEIIDSNEL 299

  Fly   451 PDFLGGPCKTMIHEGGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNL 515
            |:||||.| |...:||.:.......|     |.::   .......:...|.|.||        |:
plant   300 PEFLGGNC-TCADKGGCMRSDKGPWN-----DPDI---FKMVQNGEGKCPRKTLS--------NI 347

  Fly   516 YK---SVDLKAGFAHELLIRN----EDPKSVLTWDFDVMRNDLHFTLYRVTQELPEKNDSAVSYF 573
            .:   |||.......:...:|    |:.|.:...|..|..:.....|::.....||...|||   
plant   348 EEKTISVDENTTMKSDSFAKNKFDAENTKFIPMIDKTVNASTWPTNLHKSNYPEPEDLYSAV--- 409

  Fly   574 DLQDFVEGVNYFREEPTLICRHKESVQGSHVMHHNDSYLMHWFSPSGAQLNVFYEVLSSANYKGS 638
                          :|:. .|..|......||    |.:|...:......|:..::..:|.|.|.
plant   410 --------------KPSQ-RRGGEGYLFGGVM----SLVMGLMTVVRLTKNMPRKLTEAAIYGGE 455

  Fly   639 MTSLQSAFSSNSSAASSVQ--SRXYEKAGDGGTNGAEWRS----PALEEPIAADILTGTLM---E 694
            :...::...||....|.|:  :. .||.          ||    ||...|....|||..|.   |
plant   456 VDKAETTMVSNQEYMSMVKRMAELEEKC----------RSLDNQPAAFSPEKEQILTAALSRVDE 510

  Fly   695 KSLNLFET 702
            ..|.|.:|
plant   511 LELQLAQT 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 12/49 (24%)
CRAL_TRIO 293..456 CDD:279044 45/167 (27%)
SFH3NP_001031389.1 CRAL_TRIO_N 71..117 CDD:215024 12/56 (21%)
SEC14 137..307 CDD:214706 48/176 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2681
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 1 1.000 - - otm2464
orthoMCL 1 0.900 - - OOG6_100867
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X399
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.