DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and Sec14l3

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:411 Identity:105/411 - (25%)
Similarity:194/411 - (47%) Gaps:59/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LGQLSPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRID 278
            :|.|||.|...|.:.|:.:..|......|....:||:|.||::.:.::.|||...:.:|:...||
  Rat     5 VGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEAMLRKYMEFRKTMDID 69

  Fly   279 ALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQ 343
            .:| ::..|.|:.::.|||....|:||.|::...:|.:|.||||.|:....||:..:..||..:.
  Rat    70 HIL-DWQPPEVIQKYMPGGLCGYDRDGCPLWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILH 133

  Fly   344 KINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVF 408
            :.:...|||.:.:....::.|.|||.::|.|:|.::........:|.|||||:..:|:|:|.::|
  Rat   134 ECDLQTERLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLF 198

  Fly   409 PIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG---------PCKTMIHE 464
            |:.:.::..|:.|.||.|.:..|..   .|:||.:.:..|.:|...||         .|.|.|:.
  Rat   199 PVGYNLMKPFLSEDTRRKIVVLGNS---WKEGLLKLISPEELPAHFGGTLTDPDGNPKCLTKINY 260

  Fly   465 GGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYKSVDLKAGFAHEL 529
            ||.:||::|..:.::                            .|::|     ||.:..|.:|::
  Rat   261 GGEIPKSMYVRDQVK----------------------------TQYEH-----SVQISRGSSHQV 292

  Fly   530 LIRNEDPKSVLTWDFDVMRNDLHFTLYRVTQELPEKNDSAVSYFDLQDFVEGVNY----FREEPT 590
            ......|..||.|.|.....|:.|.::..| ::.|:..:.    ::.:.:....|    ..|:.:
  Rat   293 EYEILFPGCVLRWQFSSDGADIGFGVFLKT-KMGERQKAG----EMTEVLTSQRYNAHMVPEDGS 352

  Fly   591 LICRHKESVQGSHVMHHNDSY 611
            |.|    :..|.:|:..:::|
  Rat   353 LTC----TEAGVYVLRFDNTY 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 12/45 (27%)
CRAL_TRIO 293..456 CDD:279044 50/162 (31%)
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 12/45 (27%)
SEC14 76..245 CDD:214706 54/171 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.