DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and RLBP1

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:320 Identity:68/320 - (21%)
Similarity:128/320 - (40%) Gaps:65/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 TLDQASDQQHSILLDGDFIARSLGQLSPMQESKLLELRKMLD---------GVDDLERVPSYQT- 246
            ||.:|.|:              |.:....:|..:.||::|:.         .|...|||....: 
Human    53 TLQKAKDE--------------LNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSG 103

  Fly   247 -ILRFLAARDWHVSQAYAMLCDSLRWRREH--RIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPV 308
             .|||:.||.::|.:||.:|...:.:|.::  ..|:|..|..: ..:...:||.....||.||.|
Human   104 FFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVR-CTIEAGYPGVLSSRDKYGRVV 167

  Fly   309 YILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHL 373
            .:..:.:..    .:.:..|.:|:....|.|:.::  ||     |..:..:.::.:.:|.:|:..
Human   168 MLFNIENWQ----SQEITFDEILQAYCFILEKLLE--NE-----ETQINGFCIIENFKGFTMQQA 221

  Fly   374 WRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMK 438
            .......|..:::.::.::|.....:..:..|..|...:.:|..|:......:...:|.|.:   
Human   222 ASLRTSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLS--- 283

  Fly   439 DGLAQYLDEEIVP-DFLGGPCKTMIHEGGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQA 497
             |..|.:||.|:| ||           ||.:||          :|.:..||......|||
Human   284 -GFYQEIDENILPSDF-----------GGTLPK----------YDGKAVAEQLFGPQAQA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 17/56 (30%)
CRAL_TRIO 293..456 CDD:279044 32/163 (20%)
RLBP1XP_016877949.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.