DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and Ttpa

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_056582.1 Gene:Ttpa / 50500 MGIID:1354168 Length:278 Species:Mus musculus


Alignment Length:259 Identity:56/259 - (21%)
Similarity:114/259 - (44%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 GDFIARSLGQL---SPMQESKLLELRKMLD--GVDDLERVPSYQTILRFLAARDWHVSQAYAMLC 266
            |..:.:.|.:|   ||:.:..|.|||:.:.  ||....:..:...:||||.|||:.:..|:.::.
Mouse     7 GPLVGKQLNELPDHSPLLQPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMK 71

  Fly   267 DSLRWRREHRIDALLAEYSKPAVVVEHFPGGWHHL----DKDGRPVYILRLGHMDVKGLLKSLGM 327
            :..:||.|  ...|.|:. :|..::.....|:|.:    |..|..|.|.|:.:.|.|.....   
Mouse    72 NYYKWRAE--CPELSADL-RPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAY--- 130

  Fly   328 DGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNY 392
             .:.|::|...|..:|::......::       .:.||||..:.|.::........|...:..::
Mouse   131 -DVFRVSLITSELIVQEVETQRNGVK-------AIFDLEGWQVSHAFQITPSVAKKIAAVLTDSF 187

  Fly   393 PETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG 456
            |..:..:.::..|.:|...::::..|:.|..:.:...:|   .:.|..:.|:. .:|:|...||
Mouse   188 PLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHG---NNYKSSMLQHF-PDILPREYGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 14/47 (30%)
CRAL_TRIO 293..456 CDD:279044 29/166 (17%)
TtpaNP_056582.1 CRAL_TRIO_N 25..73 CDD:215024 14/47 (30%)
CRAL_TRIO 99..248 CDD:279044 31/164 (19%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W67 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W68 208..211 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.