DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and rlbp1b

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_991253.1 Gene:rlbp1b / 402990 ZFINID:ZDB-GENE-040426-1870 Length:307 Species:Danio rerio


Alignment Length:309 Identity:68/309 - (22%)
Similarity:127/309 - (41%) Gaps:61/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 ATKSP--TLDQASDQQHSILLDGDFIARSLGQLSPMQESKLLELR-----------KMLDGVDDL 238
            :||.|  |:.:|.|:              |.:....:.|.:.|||           ::..||.|.
Zfish    37 STKVPDHTMQKAKDE--------------LNETDEKRTSAVKELRGIIKEKAETGDELAKGVQDT 87

  Fly   239 ERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEYSKPAV---VVEHFPGGWHH 300
            ........::||:.||.:.|::||.::...:|:||::  ..|....:..||   :...:||....
Zfish    88 FGEKPDGVLVRFIRARKYDVNRAYELMKGYVRFRRDY--PELFENLTPEAVRSTIEAGYPGILSS 150

  Fly   301 LDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDL 365
            .||.||.|.:..:.:.|    .:.:..|.:||....|.|:.::  ||     |..:..:.::.:.
Zfish   151 RDKYGRVVLLFNIENWD----YEEITFDEILRAYCVILEKLLE--NE-----ETQINGFCIIENF 204

  Fly   366 EGLSMRHLWRPGIK--ALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFL 428
            :|.:|:.  ..|||  .|..:::.::.::|.....|..:..|..|...:.:|...:......:..
Zfish   205 KGFTMQQ--ASGIKPTELKKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVF 267

  Fly   429 FYGPDCAHMKDGLAQY---LDEEIVP-DFLGGPCKTMIHEGGLVPKTLY 473
            .:|       |.|..|   .|.||:| ||.|...|   ::|.:....|:
Zfish   268 VHG-------DDLENYFKEFDAEILPSDFDGKGSK---YDGKITAAHLF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 14/56 (25%)
CRAL_TRIO 293..456 CDD:279044 37/168 (22%)
rlbp1bNP_991253.1 CRAL_TRIO_N 60..117 CDD:215024 14/56 (25%)
CRAL_TRIO 143..292 CDD:279044 37/168 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.