DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and CG33965

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster


Alignment Length:217 Identity:42/217 - (19%)
Similarity:78/217 - (35%) Gaps:59/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 DCAHMKDGLAQY------LDEEIVPDFLGGPCKTMIHEGGLVPKTLYKMNSLEDHDDEVTAELPT 491
            |.|.:|:.|.:.      |:::.:..||.|.           ..:|.|.....|....:.|.:|.
  Fly    34 DIAALKEWLQKQPHLCACLEDQFLLSFLRGS-----------KFSLEKAKQKIDRFYSLQAVIPE 87

  Fly   492 TAAAQALVPGKRLSANQQHDHRNLYKSVDLKAGFAHELLIRNEDPKSVLT----WDFDVMRNDLH 552
            ....|.||           |:..:.:.:.|  |....:.:..||....:|    ..:|:  |...
  Fly    88 VFNDQRLV-----------DNAQVLEIIRL--GVILRIPLDEEDTGPAVTIIRAGSYDI--NKFK 137

  Fly   553 F-------TLYRVTQELPEKNDSAVSYFDLQDF--VEGVNYFREEPTLICRHK----ESV----Q 600
            |       :::.....|.:.|.|...|.::.|.  |.|.|.|..:|.|:.:..    |::    :
  Fly   138 FQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTRQK 202

  Fly   601 GSHVMHHNDSY------LMHWF 616
            |.|.::...::      |:.||
  Fly   203 GIHFINVPKAFETGFKSLLGWF 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024
CRAL_TRIO 293..456 CDD:279044 7/28 (25%)
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 10/53 (19%)
SEC14 101..256 CDD:238099 25/128 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.