DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and CG33523

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:489 Identity:99/489 - (20%)
Similarity:178/489 - (36%) Gaps:115/489 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 DLERVPS-YQTILRFLAARDWHVSQAYAMLCDSLRWRRE---HRID--ALLAEYSKPAVVVEHFP 295
            |::|:.: :..:.|||...|..:..::..|.::...|:.   :.||  .|..||.|...|..   
  Fly    37 DIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETCILRQSTGANDIDESELNQEYLKEGSVFV--- 98

  Fly   296 GGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWS 360
               |:.|.||:|:.:.|     ||...||..:|.|:|:.::..|.         .:.|:.:...:
  Fly    99 ---HNTDVDGKPLLVFR-----VKMHSKSKNLDELIRIVVYWVER---------TQREQHLTQLT 146

  Fly   361 LLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRS 425
            :..|:.|.|:..:   .::.:..|:||.::.||.::..:||.....|...|:.::.|.:.     
  Fly   147 IFFDMSGTSLASM---DLEFVKRIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLP----- 203

  Fly   426 KFLFYGPDCAHM-----KDGLAQYLDEEIVPDFLGGPCKTMIHEGGLVP---KTLYKMNSLEDHD 482
                  |....:     |..:.||::::......||...   :|...||   |.:.|..:....|
  Fly   204 ------PKAVEILKMISKKDINQYINKDNCLAIWGGEDN---YEFSFVPEAKKVISKPVAANAGD 259

  Fly   483 DEVTAELPTTAAAQALVPGKRLSANQQHD------HRNLYKSVDLKAGFAHELLIRNEDPKSVLT 541
            |:..|:...|....|.:..|..:.|:.|.      |.|....|:..:..|...:.......|.:|
  Fly   260 DDQFADKKVTFVDSAPMVLKETNINKMHTPSEGMLHINPKDFVNFNSKNAEATMTIKSIATSAVT 324

  Fly   542 WDFDVMRNDLHFTLYRVTQELPEKNDSAVSYFDLQDFVEGVNYFREEPT--LICRHKES-----V 599
                          |::....|||                   ||..|.  :|..::|:     :
  Fly   325 --------------YKIQTTSPEK-------------------FRVRPRCGIIQPNQEATINIWL 356

  Fly   600 QGSHVMHHN--DSYL-MHWFSP----SGAQLNVFYEVLSSANYKGSMTSLQSAFSSNSSAA---- 653
            :..|.:..:  |.:| |...:|    .||.:...:...|..:.......|...|..|.|.|    
  Fly   357 KSEHKLSDDSKDKFLVMAMVAPGGECGGADVTELWRSKSPTSADVEQHRLVCRFDENKSKAQLDC 421

  Fly   654 ---SSVQSRXYEKAGDGGTNGAEWRSPALEEPIA 684
               ||..|....|....|.:.|    .|:|..:|
  Fly   422 ASKSSKASVDCSKKSGAGVDPA----TAMERQLA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 7/31 (23%)
CRAL_TRIO 293..456 CDD:279044 32/167 (19%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 34/173 (20%)
Motile_Sperm 293..396 CDD:279029 22/135 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.