DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and Cralbp

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:266 Identity:57/266 - (21%)
Similarity:102/266 - (38%) Gaps:58/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 QESKLLELRKMLDGVDDLERVPSYQT-ILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEY 284
            :|..|.:||..:...:||:.|....| :||||.|:.:.|..|...|...|..||.....:...:|
  Fly    30 REQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDY 94

  Fly   285 SKPA---VVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKIN 346
            .:|.   ::.:.:.......||.||.|.::     :.|||                    ..||:
  Fly    95 LEPRLGDLIDQGYIFAVPQRDKHGRRVVVI-----NAKGL--------------------NPKIH 134

  Fly   347 ESAERLEKPVLNWSLLV--------------DLEGLSMRHL--WRPGIKALLNIIETVERNYPET 395
            .|.::.:...|.:..|:              |..|::..|:  |.|  .....|.:..|::.|..
  Fly   135 TSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNP--TEFARIFKWGEQSLPMR 197

  Fly   396 MGRVLVVRAPRVFPIAWTI--VSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG-- 456
            ...:.::..|..  :.|.|  |...:....:::.:.||.:...||.     :|:..:|..:||  
  Fly   198 HKEIHLINVPST--LKWLIDFVKNRVSSKMKNRLIIYGSEKELMKS-----VDQGCLPLEMGGKV 255

  Fly   457 PCKTMI 462
            |.:.||
  Fly   256 PMREMI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 16/46 (35%)
CRAL_TRIO 293..456 CDD:279044 31/180 (17%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 16/46 (35%)
SEC14 101..254 CDD:238099 32/186 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.