DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and CG32485

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:249 Identity:57/249 - (22%)
Similarity:105/249 - (42%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 QLSPMQESKLLELRKMLDGVDDLERVP-------SYQTILRFLAARDWHVSQAYAMLCDSLRWRR 273
            :|:|:.|....:|::.:..:  :|..|       |.:..||.....|    .|:..:..:.:||.
  Fly     5 ELAPINEQDFKDLKERMKLI--VEADPKQYHNDFSLRRYLRAFKTTD----DAFQAILKTNKWRE 63

  Fly   274 EHRIDAL----LAEYSKPAVVVEHFPGGWHHLDKDGRPV-YILRLGHMDVKGLLKSLGMDGLLRL 333
            .:.:|.|    .::..|.|.::       .|.|..|||| ||....|...:.:      |.|.|.
  Fly    64 TYGVDKLSEMDRSQLDKKARLL-------RHRDCIGRPVIYIPAKNHSSERDI------DELTRF 115

  Fly   334 ALHICEEGIQK-INESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMG 397
            .::..||..:| ..|..:||       .::.||...|...:   ..:.:.|:|..:.:::||.:|
  Fly   116 IVYNLEEACKKCFEEVTDRL-------CIVFDLAEFSTSCM---DYQLVQNLIWLLGKHFPERLG 170

  Fly   398 RVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVP 451
            ..|::.:|.:|...|..:...:|::|..|..|...:..     |.|||..:|:|
  Fly   171 VCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAE-----LCQYLIPDILP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 9/52 (17%)
CRAL_TRIO 293..456 CDD:279044 40/161 (25%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 39/161 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.