DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and CG13893

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:396 Identity:94/396 - (23%)
Similarity:171/396 - (43%) Gaps:63/396 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LGQLSPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRID 278
            |.::|..|.:.|.:.||.:|  |.|........::|:|.||.|::..|..||..||:.|....:|
  Fly     5 LPEISEEQRAILEKFRKQMD--DALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVD 67

  Fly   279 ALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLL---------KSLGMDGLLRLA 334
            . :.::..|..:.|:.|.|....|.:|.||.:....:.|:.|::         |.|.:  ||...
  Fly    68 N-IEKWDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVL--LLERF 129

  Fly   335 LHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMR-HLWRPGIKALLNIIETVERNYPETMGR 398
            :.|..:..||....|.:|       .:..|::.:::: :.|||..:.:::.::..|.|:||.:..
  Fly   130 MKIAYDQSQKHGWRARQL-------VVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPELLKM 187

  Fly   399 VLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG------- 456
            ..::.||::|.:|:.||..|:||:|.||.:.|.......::.|..:::.:..|...||       
  Fly   188 CYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNG 252

  Fly   457 --PCKTMIHEGGLVPKTLYKMNSLEDHD-DEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYKS 518
              .||.::..||.:|:.||...|.:..| |.|.|::|                          |.
  Fly   253 DPQCKALMVWGGKLPEELYIDQSSQQSDRDFVEAQVP--------------------------KG 291

  Fly   519 VDLKAGFAHELLIRNEDPKSVLTWDFDVMRNDLHFTLYRVTQELPEKNDSAVSYFDLQDFVEGVN 583
            ..||..|.     .|.:.:.:|:|:|.....|:.|.:|.|..:..||...........:.::.:.
  Fly   292 DKLKLHFK-----VNVEEQKILSWEFRTFDYDIKFGIYSVDDKTGEKRSEVPLGTVYSNEMDEIG 351

  Fly   584 YFREEP 589
            |....|
  Fly   352 YISTRP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 14/45 (31%)
CRAL_TRIO 293..456 CDD:279044 40/172 (23%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 14/42 (33%)
SEC14 75..246 CDD:238099 43/179 (24%)
GOLD_2 303..381 CDD:290608 11/55 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456652
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2453
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 1 1.000 - - mtm9225
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23324
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1304
SonicParanoid 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.