DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and CG10026

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:305 Identity:59/305 - (19%)
Similarity:119/305 - (39%) Gaps:61/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 TSPSDATKSPTLDQASDQQHSILLDGDFIARSLGQLS------PMQESKLLELRK--MLDGVDDL 238
            |:.|.....||:      :|.:.:..:.:...:.:|:      |..:.|::|..:  :|:..:..
  Fly     2 TTSSGCRTMPTI------EHKLNITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQ 60

  Fly   239 ERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEYSKPAVVVEHFPGGWHHL-- 301
            ......:.:.:||.||.|.:..:|.:||...|:|.:::     :.|.|..      |....|:  
  Fly    61 PHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQNK-----SFYEKVR------PLDLRHVGQ 114

  Fly   302 ----------DKDGRPVYILRLGHMDVKGLLK--SLGMDGLLRLALHICEEGIQKINESAERLEK 354
                      |:.|..:.|.|.      ||.:  .:.:|.:.|..:.:.|.|      |.|.:.:
  Fly   115 SDILTVTPYRDQHGHRILIYRF------GLWRPNQVTVDDIFRATIVLQELG------SLEPISQ 167

  Fly   355 PVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFI 419
             ::....:.||:.|.:.|:..........:|..:..:.|.....:.:|....||..|:.|...|:
  Fly   168 -IVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFL 231

  Fly   420 DEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIHE 464
            :...|.|...:|.|..    .|.::::.|.:|...||     :||
  Fly   232 NAAMREKLYIHGSDMT----SLHKHINPEHLPKRYGG-----LHE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 11/47 (23%)
CRAL_TRIO 293..456 CDD:279044 33/176 (19%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/46 (24%)
SEC14 112..265 CDD:238099 33/174 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.