DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and Ku80

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:307 Identity:56/307 - (18%)
Similarity:96/307 - (31%) Gaps:117/307 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LVMKAYERRFPTCPQMPIVLDCEVIKDESLEDGAKRNTSRRCKLAVDAPYIFKKLIGVDHVYFLQ 82
            |..|.|..:| ..|||.::|.                     :||.|.......::.|.  |..|
  Fly   363 LCWKIYSTKF-NRPQMVVLLP---------------------RLADDTHPATLYMLEVS--YTSQ 403

  Fly    83 HNFLDL-ANRTLSIEAVNESFSSRIEIFE----RCRYYAHPDNSEW------------TCFDQSA 130
            |:|.|. |.||...|...|..::..::.:    .|..........|            :.|:|:.
  Fly   404 HHFWDFPALRTTKTECSEEQLNAIDQLIDSTDLECTLRDTQQPRPWAQNDLLPFDALPSIFEQNV 468

  Fly   131 TLDIKNFFGFEHSME-KMGMKQYTQTTLKGKEIIEFFIGQLREEGITHVERWTSPSDATKSPTLD 194
            ...::....:::..| ||         ||.|...:.|              |..|.      .|:
  Fly   469 MDILERKVIYDNDKEDKM---------LKDKNFADVF--------------WRVPD------PLE 504

  Fly   195 QASDQQHSILLDGDFIARSLGQLSPMQ-----ESKLL------------------ELRKMLDGVD 236
            :.|.:..:|          :.:|.|::     :.|||                  |:....|||.
  Fly   505 EKSKRAAAI----------VKKLFPLRYSRAWQEKLLAKEQAENGVAVKSEPAEKEIPLPSDGVG 559

  Fly   237 DLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAE 283
            .::.:..::.:|    |....:|.|         ..|:.|..||.|:
  Fly   560 LIDPISDFRRVL----ASVHTISNA---------TERDARFQALAAD 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550 33/172 (19%)
CRAL_TRIO_N 222..268 CDD:215024 11/63 (17%)
CRAL_TRIO 293..456 CDD:279044
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 40/223 (18%)
Ku_PK_bind 562..663 CDD:285938 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.