DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and ttpa

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_956025.2 Gene:ttpa / 325906 ZFINID:ZDB-GENE-030131-4631 Length:285 Species:Danio rerio


Alignment Length:307 Identity:68/307 - (22%)
Similarity:131/307 - (42%) Gaps:39/307 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 KSPTLDQASDQQHSILLDGDFIARSLGQLSPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAA 253
            ||..:|: :::.:::.:|...||..|.:|....|:   |||     :.||:...::  ::|||.|
Zfish     2 KSEEVDE-TEELNNLPVDSSRIAPYLSELKEKAEA---ELR-----IRDLDLSKTF--LIRFLQA 55

  Fly   254 RDWHVSQAYAMLCDSLRWRRE-HRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMD 317
            ||:.|:.|..:|.:..:||:| ..|.|.|...|...::..::.|.....|..|..|.|.|:|   
Zfish    56 RDFDVALALKLLINYHKWRQECPEITADLRPSSVIGLLQNNYHGVLRSRDDAGSRVLIYRIG--- 117

  Fly   318 VKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALL 382
             |...|......:.|::|...|..:|:.......|:       .:.||:.....|..:.......
Zfish   118 -KWNPKEFTAYEVFRVSLITSELIVQEWETQRNGLK-------AIFDLQDWCFAHALQINPSLAK 174

  Fly   383 NIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDE 447
            .|...:..::|..:..:.::..|..|...:.::..|:.:..:.:...:|  |::.: .|..|..:
Zfish   175 KISSVLTDSFPLKVRGIHLINEPIFFRPVFAMIRPFLPDKIKQRIHMHG--CSYAR-SLCNYFPK 236

  Fly   448 EIVPDFLGGPCKTMIHEGGLVPK-----TLYKMNSLEDHDDEVTAEL 489
            .::|...||       .|..|.:     |.|.|.| ||:...::.:|
Zfish   237 AVLPPVYGG-------TGPSVDEVCQEWTEYIMQS-EDYLHRLSVDL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 15/45 (33%)
CRAL_TRIO 293..456 CDD:279044 27/162 (17%)
ttpaNP_956025.2 CRAL_TRIO_N 26..70 CDD:215024 17/53 (32%)
CRAL_TRIO 97..246 CDD:279044 29/169 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.