DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and CG31636

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster


Alignment Length:340 Identity:58/340 - (17%)
Similarity:113/340 - (33%) Gaps:86/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 MQESKLLELRKM-LDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRW------------ 271
            :||..:.||.:: .....|:|            |.|||.:.|.:...|...::            
  Fly    11 LQEICIRELNELPARMAQDIE------------ALRDWVLKQPHLRACTDDQFLLAFLRGTKFSL 63

  Fly   272 -RREHRIDALLA-EYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMD------ 328
             |.:.:.|.... :.|.|.|..|      ..|..|.:.:.|:|:      |:|..:.||      
  Fly    64 ERAKEKFDRFYTLQRSIPEVFNE------RRLATDPQVLDIVRM------GVLLQIPMDADDPGP 116

  Fly   329 -------GLLRLALHICEEGIQKINESAERL-----EKPVLNWSLLVDLEGLSMRHLWRPGIKAL 381
                   |....:.|..::.|:..:...|.:     ...|..:..::|:.|::..||:....:.|
  Fly   117 RVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLL 181

  Fly   382 LNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLD 446
            .......:...|.....:..:..|..|...:..:.:|.....:|:........|     :.:.:.
  Fly   182 SKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRISVSSDPAA-----IYELVR 241

  Fly   447 EEIVPDFLGGPCKTMIHEGGLVPKTLYKMNSLEDHDDEVTAEL----PTTAAAQALVPGKRLSAN 507
            .:.:|...||       .||          :|:|....:.|:|    |....:|......:|...
  Fly   242 RKYLPQEYGG-------TGG----------NLQDISHTMEAKLSSYGPYFRESQNFGANDKLREF 289

  Fly   508 QQH---DHRNLYKSV 519
            ..|   :||:.:.:|
  Fly   290 GDHKRGNHRSSFGAV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 11/46 (24%)
CRAL_TRIO 293..456 CDD:279044 25/180 (14%)
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 9/56 (16%)
SEC14 96..252 CDD:238099 25/173 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.