DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and CG3823

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:267 Identity:61/267 - (22%)
Similarity:98/267 - (36%) Gaps:49/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LSPMQESKLLELRKMLDGVDDLERVPSY-QTILRFLAARDWH-----VSQAYAMLCDSLRWRREH 275
            |:...|.:|:..| :.|..|.|:..|.. |.|.|.|..|..|     :|.|..:|..:...|.:|
  Fly     4 LNEKAEDQLMTTR-ISDLQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYGLRNKH 67

  Fly   276 R--------IDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDV-----KGLLKSLGM 327
            .        :||...:..:.|.:|. .||    |..:...:...||...|.     ...:|...|
  Fly    68 AHIFIDRDPLDASSQQLLQVADLVP-LPG----LTPENNKLLFYRLIDFDADKFNFTAAIKVFFM 127

  Fly   328 DGLLRLALHICEEGIQKINESAERL---EKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVE 389
            ....|.|           .|:.|||   |.||.      |:.|.::|||.:..:.||...::.|:
  Fly   128 VADCRFA-----------TENEERLSDGEIPVF------DMAGYTLRHLTKTALGALRVYMKFVQ 175

  Fly   390 RNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFL 454
            ..:|..:..:.|:..|........:|..||.........|:.|:.    |...::....::|:..
  Fly   176 EAHPVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNA----DTPYRHFPRSMLPEEY 236

  Fly   455 GGPCKTM 461
            ||....|
  Fly   237 GGEAGKM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 16/51 (31%)
CRAL_TRIO 293..456 CDD:279044 35/170 (21%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 37/174 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.