DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and Ttpal

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:374 Identity:78/374 - (20%)
Similarity:134/374 - (35%) Gaps:81/374 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 SDATK-SPTLDQASDQQ----------HSILLDGDFIARSLGQLSPMQESKLLELRKMLDGVDDL 238
            ||:.: ||::...|:.:          :...|..|.:.::..:|....|.:|.:::.:.|.|  .
  Rat     5 SDSVRTSPSVASLSENELPPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQALRDMV--R 67

  Fly   239 ERVPSYQT------ILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEYSKPAVVVEHFPGG 297
            :..|...|      :||||.||.:...:|..:|.:....||           |.|.|.....|..
  Rat    68 KEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCRR-----------SWPEVFSNLRPSA 121

  Fly   298 WHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHI-C-------------EEGIQKINES 348
            ...:...|   ::..|.|.|.:|              .|: |             .|.|:.|..:
  Rat   122 LKDVLNSG---FLTVLPHTDPRG--------------CHVLCIRPDRWIPSNYPITENIRAIYLT 169

  Fly   349 AERL----EKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFP 409
            .|:|    |..|....:|.|.:|:|:......|......:|..::..:|..:..|.:|..||:|.
  Rat   170 LEKLIQSEETQVNGVVILADYKGVSLSKASHFGPFIARKVIGILQDGFPIRIKAVHIVNEPRIFK 234

  Fly   410 IAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIHEGGLVPKTLYK 474
            ..:.|:..|:.|...::|..:|.|.:.:...|.:    .|:|...||       ..|.:....:.
  Rat   235 GIFAIIKPFLKEKIANRFFLHGSDLSSLHTSLPR----NILPKEYGG-------TAGELDTASWN 288

  Fly   475 MNSLEDHDDEVTAELPTTAA-----AQALVPGKRLSANQQHDHRNLYKS 518
            ...|...||.|.......:.     .|.|:|...:|..|..|.....||
  Rat   289 AVLLASEDDFVKEFCQPESGCDGLLGQPLLPEGLISDAQCDDSMRAMKS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 14/51 (27%)
CRAL_TRIO 293..456 CDD:279044 36/180 (20%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 12/47 (26%)
SEC14 122..278 CDD:238099 37/183 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.