DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and Rlbp1

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:304 Identity:71/304 - (23%)
Similarity:128/304 - (42%) Gaps:51/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 TLDQASDQQHSILLDGDFIARSLGQLSPMQESKLLELRKMLDGVDDLERVPSYQT--ILRFLAAR 254
            ||.:|.|:.:......|...|.|.:|...|.:...||     .|...|||.:..:  :|||:.||
  Rat    44 TLQKAKDELNEREETRDEAVRELQELVQAQAASGEEL-----AVAVAERVQARDSAFLLRFIRAR 103

  Fly   255 DWHVSQAYAMLCDSLRWRREH--RIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMD 317
            .:.|.:||.:|...:.:|.::  ..|:|..|..: ..:...:||.....||.||.|.:..:.:..
  Rat   104 KFDVGRAYELLKGYVNFRLQYPELFDSLSMEALR-CTIEAGYPGVLSSRDKYGRVVMLFNIENWH 167

  Fly   318 VKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHL--WRPGIKA 380
                .:.:..|.:|:....|.|:.::  ||     |..:..:.::.:.:|.:|:..  .||  ..
  Rat   168 ----CEEVTFDEILQAYCFILEKLLE--NE-----ETQINGFCIVENFKGFTMQQAAGLRP--SD 219

  Fly   381 LLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYL 445
            |..:::.::.::|.....:..:..|..|...:.:|..|:......:...:|.|.    ||..|.:
  Rat   220 LKKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDL----DGFFQEI 280

  Fly   446 DEEIVP-DFLGGPCKTMIHEGGLVPKTLYKMNSLEDHDDEVTAE 488
            ||.|:| ||           ||.:||          :|.:|.||
  Rat   281 DENILPADF-----------GGTLPK----------YDGKVVAE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 15/47 (32%)
CRAL_TRIO 293..456 CDD:279044 35/165 (21%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 20/61 (33%)
CRAL_TRIO 143..292 CDD:279044 36/176 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.