DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and spo20

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_593003.1 Gene:spo20 / 2543628 PomBaseID:SPAC3H8.10 Length:286 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:72/261 - (27%)
Similarity:131/261 - (50%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GQLSPMQESKL----LELRKM--LDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRR 273
            |.|:..|::.|    |||:|:  .:.:||       .|:||||.||.:::.|:..|.....:||:
pombe    22 GHLNSTQQATLDSMRLELQKLGYTERLDD-------ATLLRFLRARKFNLQQSLEMFIKCEKWRK 79

  Fly   274 EHRIDALLA--EYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALH 336
            |..:|.|:.  .|.:...|.:::|..:|..|.||||||:.:||::|:|.|.:....:.:::..::
pombe    80 EFGVDDLIKNFHYDEKEAVSKYYPQFYHKTDIDGRPVYVEQLGNIDLKKLYQITTPERMMQNLVY 144

  Fly   337 ICEEGIQKINESAERLEKPVLNWS-LLVDLEGLSMRHLWRPGIKALLNIIETVER-------NYP 393
            ..|....|...:..|....::..| .::||:|:        ||.::.::...:.:       .||
pombe   145 EYEMLALKRFPACSRKAGGLIETSCTIMDLKGV--------GITSIHSVYSYIRQASSISQDYYP 201

  Fly   394 ETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPC 458
            |.||:..|:.||..|..|:.::..|:||.|..|....|   ::.|..|.:.:..:.:|..|||.|
pombe   202 ERMGKFYVINAPWGFSSAFNLIKGFLDEATVKKIHILG---SNYKSALLEQIPADNLPAKLGGNC 263

  Fly   459 K 459
            :
pombe   264 Q 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 16/51 (31%)
CRAL_TRIO 293..456 CDD:279044 43/170 (25%)
spo20NP_593003.1 CRAL_TRIO_N 29..74 CDD:215024 16/51 (31%)
SEC14 94..264 CDD:214706 46/180 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I2933
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 1 1.000 - - otm47220
orthoMCL 1 0.900 - - OOG6_100867
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1304
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.