DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and CG30339

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:352 Identity:70/352 - (19%)
Similarity:123/352 - (34%) Gaps:89/352 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LGQLSPMQESKLLELRKM----LDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRRE 274
            :..|.|:.    .|||::    |:.|:  ||||:     ...|.|||...|.:      ||.|::
  Fly     1 MANLRPLS----AELRRIAETELNEVE--ERVPA-----DLKALRDWLAKQPH------LRARQD 48

  Fly   275 HRIDALLAEY--------SKPAVVVEHF-------PGGWHHLDKDGRPVYILRLGHMDVKGLLKS 324
               |..|..:        .|....::||       |..:.....|.|.:.:.|.|  ....|.|.
  Fly    49 ---DQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLMPELFGKRLVDERNLILCRSG--TYVRLPKP 108

  Fly   325 LGMDG--------------------LLRLALHICEEGIQKINES-----AERLEKPVLNWSLLVD 364
            .|.||                    |.|....|.|:.|::.:.|     .|.::...::.|.|..
  Fly   109 WGTDGPRLQLTNYEKFDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQ 173

  Fly   365 LEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLF 429
            |:...::   |.||.|        |:..|..:..|.::..|:.......:..:.:....:.:|..
  Fly   174 LDFTLIK---RMGIFA--------EKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHV 227

  Fly   430 YGPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIHEGGLVPKTLYKMNSLEDHDDEVTAELPTTAA 494
            |     ...:.|.:.:..|.:|:..||....:........|.|....|....|.:...:      
  Fly   228 Y-----KNLEQLNEVIPREYLPEEYGGNNGRIADIQAEAEKKLLSYESYFAEDSQYGVD------ 281

  Fly   495 AQALVPGKRLSANQQHDHRNLYKSVDL 521
             :.|.||||::|:........::.:|:
  Fly   282 -EQLRPGKRVNADSIFGAEGSFRKLDI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 14/49 (29%)
CRAL_TRIO 293..456 CDD:279044 35/194 (18%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 11/55 (20%)
CRAL_TRIO 109..250 CDD:279044 27/156 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.