DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and SEC14L2

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens


Alignment Length:439 Identity:117/439 - (26%)
Similarity:204/439 - (46%) Gaps:81/439 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LGQLSPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRID 278
            :|.|||.|:..|.:.|:.:..|......|....:||:|.||.:.:.::.|||...:.:|::..||
Human     5 VGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDID 69

  Fly   279 ALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQ 343
            .::: :..|.|:.::..||....|.||.||:...:|.:|.||||.|.....|||..:..||..:|
Human    70 NIIS-WQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQ 133

  Fly   344 KINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVF 408
            :......:|.:.|...:::.|.|||.::|||:|.::|....:...|.|||||:.|:.||:||::|
Human   134 ECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLF 198

  Fly   409 PIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG---------PCKTMIHE 464
            |:|:.::..|:.|.||.|.:..|   |:.|:.|.:::..:.||...||         .||:.|:.
Human   199 PVAYNLIKPFLSEDTRKKIMVLG---ANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINY 260

  Fly   465 GGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYKSVDLKAGFAHEL 529
            ||.:|:..|..:.::                            ||::|     ||.:..|.:|::
Human   261 GGDIPRKYYVRDQVK----------------------------QQYEH-----SVQISRGSSHQV 292

  Fly   530 LIRNEDPKSVLTWDFDVMRNDLHFTLY------------RVTQELPEKNDSAVSYFDLQDFVEGV 582
            ......|..||.|.|.....|:.|.::            .:|:.||.:..::             
Human   293 EYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNS------------- 344

  Fly   583 NYFREEPTLICRHKESVQGSHVMHHNDSY-LMHWFSPSGAQLNVFYEVL 630
            :...|:.||.|    |..|.:|:..:::| .:|     ..::|...|||
Human   345 HLVPEDGTLTC----SDPGIYVLRFDNTYSFIH-----AKKVNFTVEVL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 12/45 (27%)
CRAL_TRIO 293..456 CDD:279044 56/162 (35%)
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 12/45 (27%)
SEC14 76..244 CDD:214706 59/170 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1304
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.