DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and Rlbp1

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:313 Identity:68/313 - (21%)
Similarity:131/313 - (41%) Gaps:69/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 TLDQASDQQHSILLDGDFIARSLGQLSPMQESKLLELRKMLDGV----DDL-----ERVPSYQT- 246
            ||.:|.|:              |.:....:|..:.||::::...    ::|     |||.:..: 
Mouse    44 TLQKAKDE--------------LNEKEETREEAVRELQELVQAQAASGEELALAVAERVQARDSA 94

  Fly   247 -ILRFLAARDWHVSQAYAMLCDSLRWRREH--RIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPV 308
             :|||:.||.:.|.:||.:|...:.:|.::  ..|:|..|..: ..:...:||.....||.||.|
Mouse    95 FLLRFIRARKFDVGRAYELLKGYVNFRLQYPELFDSLSMEALR-CTIEAGYPGVLSSRDKYGRVV 158

  Fly   309 YILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHL 373
            .:..:.:..    .:.:..|.:|:....|.|:.::  ||     |..:..:.::.:.:|.:|:..
Mouse   159 MLFNIENWH----CEEVTFDEILQAYCFILEKLLE--NE-----ETQINGFCIVENFKGFTMQQA 212

  Fly   374 --WRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAH 436
              .||  ..|..:::.::.::|.....:..:..|..|...:.:|..|:......:...:|.|.  
Mouse   213 AGLRP--SDLKKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDL-- 273

  Fly   437 MKDGLAQYLDEEIVP-DFLGGPCKTMIHEGGLVPKTLYKMNSLEDHDDEVTAE 488
              ||..|.:||.|:| ||           ||.:||          :|.:|.||
Mouse   274 --DGFFQEIDENILPADF-----------GGTLPK----------YDGKVVAE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 16/56 (29%)
CRAL_TRIO 293..456 CDD:279044 35/165 (21%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 16/56 (29%)
CRAL_TRIO 143..292 CDD:395525 36/176 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.